Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GORAB AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit anti-Human GORAB Polyclonal Antibody | anti-GORAB antibody

GORAB antibody - C-terminal region

Gene Names
GORAB; GO; NTKLBP1; SCYL1BP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GORAB; Polyclonal Antibody; GORAB antibody - C-terminal region; anti-GORAB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERLLHEQEVESRRPVVRLERPFQPAEESVTLEFAKENRKCQEQAVSPKVD
Sequence Length
394
Applicable Applications for anti-GORAB antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GORAB AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-GORAB AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-GORAB antibody
This is a rabbit polyclonal antibody against GORAB. It was validated on Western Blot

Target Description: This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions with the N-terminal kinase-like protein, and thus it may function in mitosis. Mutations in this gene have been associated with geroderma osteodysplastica.
Product Categories/Family for anti-GORAB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
RAB6-interacting golgin isoform a
NCBI Official Synonym Full Names
golgin, RAB6 interacting
NCBI Official Symbol
GORAB
NCBI Official Synonym Symbols
GO; NTKLBP1; SCYL1BP1
NCBI Protein Information
RAB6-interacting golgin
UniProt Protein Name
RAB6-interacting golgin
Protein Family
UniProt Gene Name
GORAB
UniProt Synonym Gene Names
NTKLBP1; SCYL1BP1; NTKL-BP1; NTKL-binding protein 1; hNTKL-BP1; SCYL1-BP1; SCYL1-binding protein 1
UniProt Entry Name
GORAB_HUMAN

NCBI Description

This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions with the N-terminal kinase-like protein, and thus it may function in mitosis. Mutations in this gene have been associated with geroderma osteodysplastica. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]

Uniprot Description

SCYL1BP1: Defects in GORAB are the cause of geroderma osteodysplasticum (GO); also known as gerodermia osteodysplastica or Walt Disney dwarfism. GO is a rare autosomal recessive disorder characterized by lax, wrinkled skin, joint laxity and a typical face with a prematurely aged appearance. Skeletal signs include severe osteoporosis leading to frequent fractures, malar and mandibular hypoplasia and a variable degree of growth retardation. Belongs to the GORAB family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 1q24.2

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding

Disease: Geroderma Osteodysplasticum

Research Articles on GORAB

Similar Products

Product Notes

The GORAB gorab (Catalog #AAA3215711) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GORAB antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GORAB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GORAB gorab for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERLLHEQEVE SRRPVVRLER PFQPAEESVT LEFAKENRKC QEQAVSPKVD. It is sometimes possible for the material contained within the vial of "GORAB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.