Single-minded homolog 2 (Sim2) Recombinant Protein | Sim2 recombinant protein
Recombinant Mouse Single-minded homolog 2 (Sim2)
Gene Names
Sim2; bHLHe15
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Single-minded homolog 2 (Sim2); Recombinant Mouse Single-minded homolog 2 (Sim2); Sim2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-657, Full length protein
Sequence
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGLGDAWGQPSRTGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELTGNSIYEYIHPSDHDEMTAVLTAHPPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGYKVIHCSGYLKIRQYMLDMSLYDSCYQIVGLVAVGQSLPPSAITEIKLHSNMFMFRASLDLKLIFLDSRVTELTGYEPQDLIEKTLYHHVHGCDTFHLRYAHHLLLVKGQVTTKYYRLLSKLGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTDVEYKELQLSLDQVSTSKSQESWRTTLSTSQETRKSAKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECSQVGNWRTSPPTNAVAPPEQQLHSEASDLLYGPPYSLPFSYHYGHFPLDSHVFSSKKPGLPAKFGQPQGSPCEVARFFLSTLPASSECQWHCANSLVPSSSSPAKNLSEPSPVNAARHGLVPNYEAPSAAARRFCEDPAPPSFPSCGHYREEPALGPAKAPRQASRDAARLALARAPPECCAPPAPEPQAPAQLPFVLLNYHRVLARRGPLGSAAPGAPEAAGSLRPRHPGPVAASAPGAPRPHYLGASVIITNGR
Sequence Length
657
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Sim2 recombinant protein
SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. The Drosophila sim gene encodes a transcription factor that is a master regulator of fruit fly neurogenesis. SIM2 maps within the so-called Down syndrome chromosomal region. Based on the mapping position, its potential function as transcriptional repressor and similarity to Drosophila sim, it is proposed that SIM2 may contribute to some specific Down syndrome phenotypes
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
72,513 Da
NCBI Official Full Name
single-minded homolog 2
NCBI Official Synonym Full Names
single-minded family bHLH transcription factor 2
NCBI Official Symbol
Sim2
NCBI Official Synonym Symbols
bHLHe15
NCBI Protein Information
single-minded homolog 2
UniProt Protein Name
Single-minded homolog 2
Protein Family
UniProt Gene Name
Sim2
UniProt Synonym Gene Names
mSIM
Uniprot Description
Transcription factor that may be a master gene of CNS development in cooperation with Arnt. It may have pleiotropic effects in the tissues expressed during development.
Research Articles on Sim2
Similar Products
Product Notes
The Sim2 sim2 (Catalog #AAA1279029) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-657, Full length protein. The amino acid sequence is listed below: MKEKSKNAAK TRREKENGEF YELAKLLPLP SAITSQLDKA SIIRLTTSYL KMRAVFPEGL GDAWGQPSRT GPLDSVAKEL GSHLLQTLDG FVFVVASDGK IMYISETASV HLGLSQVELT GNSIYEYIHP SDHDEMTAVL TAHPPLHHHL LQEYEIERSF FLRMKCVLAK RNAGLTCSGY KVIHCSGYLK IRQYMLDMSL YDSCYQIVGL VAVGQSLPPS AITEIKLHSN MFMFRASLDL KLIFLDSRVT ELTGYEPQDL IEKTLYHHVH GCDTFHLRYA HHLLLVKGQV TTKYYRLLSK LGGWVWVQSY ATVVHNSRSS RPHCIVSVNY VLTDVEYKEL QLSLDQVSTS KSQESWRTTL STSQETRKSA KPKNTKMKTK LRTNPYPPQQ YSSFQMDKLE CSQVGNWRTS PPTNAVAPPE QQLHSEASDL LYGPPYSLPF SYHYGHFPLD SHVFSSKKPG LPAKFGQPQG SPCEVARFFL STLPASSECQ WHCANSLVPS SSSPAKNLSE PSPVNAARHG LVPNYEAPSA AARRFCEDPA PPSFPSCGHY REEPALGPAK APRQASRDAA RLALARAPPE CCAPPAPEPQ APAQLPFVLL NYHRVLARRG PLGSAAPGAP EAAGSLRPRH PGPVAASAPG APRPHYLGAS VIITNGR. It is sometimes possible for the material contained within the vial of "Single-minded homolog 2 (Sim2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
