Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SIM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)

Rabbit SIM2 Polyclonal Antibody | anti-SIM2 antibody

SIM2 antibody - N-terminal region

Gene Names
SIM2; SIM; bHLHe15; HMC13F06; HMC29C01
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SIM2; Polyclonal Antibody; SIM2 antibody - N-terminal region; anti-SIM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYL
Sequence Length
667
Applicable Applications for anti-SIM2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SIM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SIM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)

Western Blot (WB) (WB Suggested Anti-SIM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)
Related Product Information for anti-SIM2 antibody
This is a rabbit polyclonal antibody against SIM2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. The Drosophila sim gene encodes a transcription factor that is a master regulator of fruit fly neurogenesis. SIM2 maps within the so-called Down syndrome chromosomal region. Based on t

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
Single-minded homolog 2
NCBI Official Synonym Full Names
SIM bHLH transcription factor 2
NCBI Official Symbol
SIM2
NCBI Official Synonym Symbols
SIM; bHLHe15; HMC13F06; HMC29C01
NCBI Protein Information
single-minded homolog 2
UniProt Protein Name
Single-minded homolog 2
Protein Family
UniProt Gene Name
SIM2
UniProt Synonym Gene Names
BHLHE15; bHLHe15
UniProt Entry Name
SIM2_HUMAN

NCBI Description

This gene represents a homolog of the Drosophila single-minded (sim) gene, which encodes a transcription factor that is a master regulator of neurogenesis. The encoded protein is ubiquitinated by RING-IBR-RING-type E3 ubiquitin ligases, including the parkin RBR E3 ubiquitin protein ligase. This gene maps within the so-called Down syndrome chromosomal region, and is thus thought to contribute to some specific Down syndrome phenotypes. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2014]

Uniprot Description

SIM2: Transcription factor that may be a master gene of CNS development in cooperation with Arnt. It may have pleiotropic effects in the tissues expressed during development. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 21q22.13

Cellular Component: nucleoplasm

Molecular Function: signal transducer activity; DNA binding; protein heterodimerization activity; transcription factor activity

Biological Process: nervous system development; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; embryonic pattern specification; cell differentiation; signal transduction; lung development

Research Articles on SIM2

Similar Products

Product Notes

The SIM2 sim2 (Catalog #AAA3204142) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIM2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SIM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SIM2 sim2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKEKSKNAAK TRREKENGEF YELAKLLPLP SAITSQLDKA SIIRLTTSYL. It is sometimes possible for the material contained within the vial of "SIM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.