Interleukin-1 beta Recombinant Protein | Il1b recombinant protein

Recombinant Mouse Interleukin-1 beta protein

Cat. Num. AAA1265504

• Gene Names: Il1b; Il-1b; IL-1beta
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-1 beta; Recombinant Mouse Interleukin-1 beta protein; Il1b recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 119-268aa; Partial
• Sequence: PIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVS
• Sequence Length: 269

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Il1b recombinant protein

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

References

Two interleukin 1 genes in the mouse cloning and expression of the cDNA for murine interleukin 1 beta.Gray P.W., Glaister D., Chen E., Goeddel D.V., Pennica D.J. Immunol. 137:3644-3648(1986) The murine interleukin 1 beta gene structure and evolution.Telford J.L., Macchia G., Massone A., Carinci V., Palla E., Melli M.Nucleic Acids Res. 14:9955-9963(1986) Characterization of quantitative trait loci influencing growth and adiposity using congenic mouse strains.Farber C.R., Corva P.M., Medrano J.F. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Characterization of murine IL-1 beta. Isolation, expression, and purification.Huang J.J., Newton R.C., Rutledge S.J., Horuk R., Matthew J.B., Covington M., Lin Y.J. Immunol. 140:3838-3843(1988) The structure of murine interleukin-1 beta at 2.8-A resolution.van Oostrum J., Priestle J.P., Gruetter M.G., Schmitz A.J. Struct. Biol. 107:189-195(1991)

NCBI and Uniprot Product Information

• NCBI GI #: 6680415
• NCBI GeneID: 16176
• NCBI Accession #: NP_032387.1
• NCBI GenBank Nucleotide #: NM_008361.4
• UniProt Accession #: P10749; Q2M4J6
• Molecular Weight: 21.2 kDa
• NCBI Official Full Name: interleukin-1 beta
• NCBI Official Synonym Full Names: interleukin 1 beta
• NCBI Official Symbol: Il1b
• NCBI Official Synonym Symbols: Il-1b; IL-1beta
• NCBI Protein Information: interleukin-1 beta
• UniProt Protein Name: Interleukin-1 beta
• Protein Family: Interleukin
• UniProt Gene Name: Il1b
• UniProt Synonym Gene Names: IL-1 beta
• UniProt Entry Name: IL1B_MOUSE

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response. [provided by RefSeq, Aug 2015]

Uniprot Description

IL1B: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Monomer. Belongs to the IL-1 family.

Protein type: Cytokine

Cellular Component: cytoplasm; cytoplasmic vesicle; extracellular region; extracellular space; lysosome; secretory granule; vesicle

Molecular Function: cytokine activity; interleukin-1 receptor binding; protein domain specific binding; receptor binding

Biological Process: activation of MAPK activity; activation of NF-kappaB transcription factor; aging; cytokine and chemokine mediated signaling pathway; elevation of cytosolic calcium ion concentration; fever; germ cell programmed cell death; hyaluronan biosynthetic process; immune response; inflammatory response; inflammatory response to antigenic stimulus; interleukin-1 beta production; leukocyte migration; lipopolysaccharide-mediated signaling pathway; MAPKKK cascade; memory; negative regulation of cell proliferation; negative regulation of glutamate secretion; negative regulation of insulin receptor signaling pathway; negative regulation of lipid catabolic process; negative regulation of lipid metabolic process; negative regulation of MAP kinase activity; negative regulation of neurogenesis; negative regulation of neuron differentiation; negative regulation of transcription from RNA polymerase II promoter; neutrophil chemotaxis; positive regulation of angiogenesis; positive regulation of apoptosis; positive regulation of astrocyte differentiation; positive regulation of cell division; positive regulation of chemokine biosynthetic process; positive regulation of fever; positive regulation of glial cell differentiation; positive regulation of granulocyte macrophage colony-stimulating factor production; positive regulation of heterotypic cell-cell adhesion; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of immature T cell proliferation in the thymus; positive regulation of interferon-gamma production; positive regulation of interleukin-2 biosynthetic process; positive regulation of interleukin-6 biosynthetic process; positive regulation of interleukin-6 production; positive regulation of interleukin-8 production; positive regulation of JNK activity; positive regulation of JNK cascade; positive regulation of lipid catabolic process; positive regulation of membrane protein ectodomain proteolysis; positive regulation of mitosis; positive regulation of NF-kappaB import into nucleus; positive regulation of nitric oxide biosynthetic process; positive regulation of phagocytosis; positive regulation of prostaglandin secretion; positive regulation of protein amino acid phosphorylation; positive regulation of stress-activated MAPK cascade; positive regulation of T cell proliferation; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; protein kinase B signaling cascade; regulation of I-kappaB kinase/NF-kappaB cascade; regulation of insulin secretion; regulation of nitric-oxide synthase activity; response to ATP; response to carbohydrate stimulus; response to lipopolysaccharide; sequestering of triacylglycerol; social behavior