SDS-PAGE
Interleukin-1 alpha Recombinant Protein | IL1A recombinant protein
Recombinant human Interleukin-1 alpha protein
Gene Names
IL1A; IL1; IL-1A; IL1F1; IL1-ALPHA
Applications
SDS-Page, ELISA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-1 alpha; Recombinant human Interleukin-1 alpha protein; Hematopoietin-1; IL1A recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Applicable Applications for IL1A recombinant protein
SDS-PAGE, ELISA (EIA)
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for IL1A recombinant protein
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
24 KD
NCBI Official Full Name
interleukin-1 alpha proprotein
NCBI Official Synonym Full Names
interleukin 1, alpha
NCBI Official Symbol
IL1A
NCBI Official Synonym Symbols
IL1; IL-1A; IL1F1; IL1-ALPHA
NCBI Protein Information
interleukin-1 alpha
Protein Family
Research Articles on IL1A
Similar Products
Product Notes
The IL1A (Catalog #AAA959986) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Interleukin-1 alpha can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA (EIA). Researchers should empirically determine the suitability of the IL1A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SAPFSFLSNV KYNFMRIIKY EFILNDALNQ SIIRANDQYL TAAALHNLDE AVKFDMGAYK SSKDDAKITV ILRISKTQLY VTAQDEDQPV LLKEMPEIPK TITGSETNLL FFWETHGTKN YFTSVAHPNL FIATKQDYWV CLAGGPPSIT DFQILENQA. It is sometimes possible for the material contained within the vial of "Interleukin-1 alpha, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
