Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Interleukin-1 beta Recombinant Protein | IL1B recombinant protein

Recombinant Human Interleukin-1 beta

Gene Names
IL1B; IL-1; IL1F2; IL1-BETA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-1 beta; Recombinant Human Interleukin-1 beta; Catabolin; IL1B recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
117-269
Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Sequence Length
269
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for IL1B recombinant protein
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Product Categories/Family for IL1B recombinant protein
References
"Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs." March C.J., Mosley B., Larsen A., Cerretti D.P., Braedt G., Price V., Gillis S., Henney C.S., Kronheim S.R., Grabstein K., Conlon P.J., Hopp T.P., Cosman D. Nature 315:641-647(1985)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.37kD
NCBI Official Full Name
interleukin-1 beta proprotein
NCBI Official Synonym Full Names
interleukin 1 beta
NCBI Official Symbol
IL1B
NCBI Official Synonym Symbols
IL-1; IL1F2; IL1-BETA
UniProt Protein Name
Interleukin-1 beta
Protein Family
UniProt Gene Name
IL1B
UniProt Synonym Gene Names
IL1F2; IL-1 beta
UniProt Entry Name
IL1B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2008]

Uniprot Description

IL1B: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Monomer. Belongs to the IL-1 family.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q14

Cellular Component: autophagic vacuole; cytosol; extracellular region; extracellular space; lysosome; secretory granule

Molecular Function: cytokine activity; interleukin-1 receptor binding; protein domain specific binding

Biological Process: activation of MAPK activity; activation of NF-kappaB transcription factor; aging; apoptosis; cell-cell signaling; chronic inflammatory response to antigenic stimulus; cytokine and chemokine mediated signaling pathway; elevation of cytosolic calcium ion concentration; embryo implantation; estrogen metabolic process; fever; germ cell programmed cell death; glycoprotein metabolic process; hyaluronan biosynthetic process; inflammatory response; inflammatory response to antigenic stimulus; innate immune response; interleukin-1 beta production; lipopolysaccharide-mediated signaling pathway; MAPKKK cascade; memory; negative regulation of cell proliferation; negative regulation of glutamate secretion; negative regulation of insulin receptor signaling pathway; negative regulation of lipid catabolic process; negative regulation of lipid metabolic process; negative regulation of MAP kinase activity; negative regulation of neuron differentiation; negative regulation of transcription from RNA polymerase II promoter; neutrophil chemotaxis; ovulation; pentacyclic triterpenoid metabolic process; polyketide metabolic process; positive regulation of angiogenesis; positive regulation of apoptosis; positive regulation of astrocyte differentiation; positive regulation of chemokine biosynthetic process; positive regulation of fever; positive regulation of granulocyte macrophage colony-stimulating factor production; positive regulation of heterotypic cell-cell adhesion; positive regulation of histone acetylation; positive regulation of histone phosphorylation; positive regulation of immature T cell proliferation in the thymus; positive regulation of interferon-gamma production; positive regulation of interleukin-2 biosynthetic process; positive regulation of interleukin-6 biosynthetic process; positive regulation of interleukin-6 production; positive regulation of interleukin-8 production; positive regulation of JNK activity; positive regulation of lipid catabolic process; positive regulation of membrane protein ectodomain proteolysis; positive regulation of mitosis; positive regulation of NF-kappaB import into nucleus; positive regulation of nitric oxide biosynthetic process; positive regulation of phagocytosis; positive regulation of prostaglandin secretion; positive regulation of protein amino acid phosphorylation; positive regulation of protein export from nucleus; positive regulation of T cell mediated immunity; positive regulation of T cell proliferation; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; positive regulation of vascular endothelial growth factor receptor signaling pathway; protein kinase B signaling cascade; purine base metabolic process; regulation of I-kappaB kinase/NF-kappaB cascade; regulation of insulin secretion; regulation of nitric-oxide synthase activity; response to ATP; response to estradiol stimulus; response to ethanol; response to gamma radiation; response to heat; response to hypoxia; response to L-ascorbic acid; response to morphine; response to ozone; response to peptide hormone stimulus; response to vitamin D; sequestering of triacylglycerol; signal transduction; smooth muscle adaptation; social behavior; stimulatory C-type lectin receptor signaling pathway; wound healing

Disease: Gastric Cancer, Hereditary Diffuse

Research Articles on IL1B

Similar Products

Product Notes

The IL1B il1b (Catalog #AAA969546) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 117-269. The amino acid sequence is listed below: APVRSLNCTL RDSQQKSLVM SGPYELKALH LQGQDMEQQV VFSMSFVQGE ESNDKIPVAL GLKEKNLYLS CVLKDDKPTL QLESVDPKNY PKKKMEKRFV FNKIEINNKL EFESAQFPNW YISTSQAENM PVFLGGTKGG QDITDFTMQF VSS. It is sometimes possible for the material contained within the vial of "Interleukin-1 beta, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.