Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mitogen-activated protein kinase kinase kinase 1 protein Recombinant Protein | MAP3K1 recombinant protein

Recombinant mouse Mitogen-activated protein kinase kinase kinase 1 protein

Gene Names
MAP3K1; MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitogen-activated protein kinase kinase kinase 1 protein; Recombinant mouse Mitogen-activated protein kinase kinase kinase 1 protein; MAP3K1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
TALQRRRVAERPADRPRSIFFLLPSTGCGDWDFNGCETGDVRQKHILRAGGGGGSVEGRDPDDGSPQPSKHHPDAGGHVREEQLQPLHVDGGRICGSPLEIRSFQGVSRHLHAVTPWPFLSPREPDHSQRRQRCQPAHQHRSEAENCRLWSCCQVGIKRNRCRRVPGTVTGDNCIHGAGPKRSAVWELCMECWLRHYRNGLCKTTLECRKTLQSSRLDIDCRNYCTVHPVTPVPGSARRGAALLRTSASGPASVQRAAETSGLPYHV
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
164,470 Da
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
NCBI Official Symbol
MAP3K1
NCBI Official Synonym Symbols
MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
NCBI Protein Information
mitogen-activated protein kinase kinase kinase 1; MEK kinase 1; MAP/ERK kinase kinase 1; MAPK/ERK kinase kinase 1
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase 1
UniProt Gene Name
MAP3K1
UniProt Synonym Gene Names
MAPKKK1; MEKK; MEKK1; MEK kinase 1; MEKK 1
UniProt Entry Name
M3K1_HUMAN

NCBI Description

The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus. [provided by RefSeq, Mar 2012]

Uniprot Description

MEKK1: a protein kinase of the STE11 family. Phosphorylates and activates MKK4 and -7, which in turn activate JNK1, -2 and -3. Contains 1 RING-type zinc finger. The RING finger domain of MEKK1 exhibits E3 ubiquitin ligase activity toward c-Jun. c-Jun is downregulated in response to osmotic stress via ubiquitination-mediated degradation by the RING finger domain of MEKK1. Overexpressed/overactivated in multiple tumor types. The Mek1/2 inhibitor U0126 blocks export of influenza viral particles and has been suggested as an antiviral treatment. Single mutations at the same point of each gene also associated with cardiofaciocutaneous syndrome, (also linked with Braf and Kras mutations), displaying morphological, cardiac and mental defects. Inhibitors: U0126, CI-1040/PD184352, PD-0325901 (Phase I cancer), ARRY-142886 (Phase 1, cancer).

Protein type: Kinase, protein; Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); Ubiquitin ligase; Ligase; EC 2.7.11.25; Ubiquitin conjugating system; STE group; STE11 family

Chromosomal Location of Human Ortholog: 5q11.2

Cellular Component: cytosol

Molecular Function: protein binding; MAP kinase kinase kinase activity; zinc ion binding; JUN kinase kinase activity; protein kinase binding; ATP binding; protein kinase activity

Biological Process: wound healing; activation of MAPKK activity; apoptosis; protein amino acid phosphorylation; regulation of cell migration; activation of JNK activity; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; apoptotic mitochondrial changes; positive regulation of actin filament polymerization; transforming growth factor beta receptor signaling pathway; toll-like receptor signaling pathway; innate immune response; toll-like receptor 9 signaling pathway; actin cytoskeleton organization and biogenesis; toll-like receptor 4 signaling pathway

Disease: 46,xy Sex Reversal 6

Research Articles on MAP3K1

Similar Products

Product Notes

The MAP3K1 map3k1 (Catalog #AAA1265377) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TALQRRRVAE RPADRPRSIF FLLPSTGCGD WDFNGCETGD VRQKHILRAG GGGGSVEGRD PDDGSPQPSK HHPDAGGHVR EEQLQPLHVD GGRICGSPLE IRSFQGVSRH LHAVTPWPFL SPREPDHSQR RQRCQPAHQH RSEAENCRLW SCCQVGIKRN RCRRVPGTVT GDNCIHGAGP KRSAVWELCM ECWLRHYRNG LCKTTLECRK TLQSSRLDID CRNYCTVHPV TPVPGSARRG AALLRTSASG PASVQRAAET SGLPYHV. It is sometimes possible for the material contained within the vial of "Mitogen-activated protein kinase kinase kinase 1 protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.