Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Flagellar hook-associated protein 2 (fliD) Recombinant Protein | fliD recombinant protein

Recombinant Helicobacter pylori Flagellar hook-associated protein 2 (fliD), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Flagellar hook-associated protein 2 (fliD); Recombinant Helicobacter pylori Flagellar hook-associated protein 2 (fliD); partial; fliD recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
433-668, fragment, Flagellar hook-associated 2, C-terminal
Sequence
ASDSAFTYNGVSITRPTNEVNDVISGVNITLEQTTEPNKPAIISVSRDNQAIIDSLTEFVKAYNELIPKLDEDTRYDADTKIAGIFNGVGDIRAIRSSLNNVFSYSVHTDNGVESLMKYGLSLDDKGVMSLDEAKLSSALNSNPKATQDFFYGSDSKDMGGREIHQEGIFSKFNQVIANLIDGGNAKLKIYEDSLDRDAKSLTKDKENAQELLKTRYNIMAERFAAYDSQISKANQ
Sequence Length
668
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74,131 Da
NCBI Official Full Name
flagellar hook-associated protein
NCBI Official Symbol
fliD
NCBI Protein Information
flagellar hook-associated protein
UniProt Protein Name
Flagellar hook-associated protein 2
UniProt Gene Name
fliD
UniProt Synonym Gene Names
HAP2

Uniprot Description

Required for the morphogenesis and for the elongation of the flagellar filament by facilitating polymerization of the flagellin monomers at the tip of growing filament. Forms a capping structure, which prevents flagellin subunits (transported through the central channel of the flagellum) from leaking out without polymerization at the distal end. Essential to colonize and establish infection in gastric mucosa as a result of its essential role in motility. Has effect on flaA gene transcription.

Similar Products

Product Notes

The fliD flid (Catalog #AAA1264618) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 433-668, fragment, Flagellar hook-associated 2, C-terminal. The amino acid sequence is listed below: ASDSAFTYNG VSITRPTNEV NDVISGVNIT LEQTTEPNKP AIISVSRDNQ AIIDSLTEFV KAYNELIPKL DEDTRYDADT KIAGIFNGVG DIRAIRSSLN NVFSYSVHTD NGVESLMKYG LSLDDKGVMS LDEAKLSSAL NSNPKATQDF FYGSDSKDMG GREIHQEGIF SKFNQVIANL IDGGNAKLKI YEDSLDRDAK SLTKDKENAQ ELLKTRYNIM AERFAAYDSQ ISKANQ . It is sometimes possible for the material contained within the vial of "Flagellar hook-associated protein 2 (fliD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.