Eukaryotic initiation factor 4A-1 (Os06g0701100, LOC_Os06g48750) Recombinant Protein | Os06g0701100 recombinant protein

Recombinant Oryza sativa subsp. japonica Eukaryotic initiation factor 4A-1 (Os06g0701100, LOC_Os06g48750)

Cat. Num. AAA1244273

• Gene Names: LOC4341966; eIF-4A-1; OsJ_22532; P0596H10.2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Eukaryotic initiation factor 4A-1 (Os06g0701100; LOC_Os06g48750); Recombinant Oryza sativa subsp. japonica Eukaryotic initiation factor 4A-1 (Os06g0701100; Os06g0701100 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-414, Full length protein
• Sequence: MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPSKIQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPANVADLL
• Sequence Length: 414

• Species: Oryza sativa subsp. japonica (Rice)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 1002277658
• NCBI GeneID: 4341966
• NCBI Accession #: XP_015643172.1
• NCBI GenBank Nucleotide #: XM_015787686.1
• UniProt Accession #: P35683; Q0D9S8; Q54AC9; Q5Z847; B7EPR0
• Molecular Weight: 47,088 Da
• NCBI Official Full Name: eukaryotic initiation factor 4A-1
• NCBI Official Symbol: LOC4341966
• NCBI Official Synonym Symbols: eIF-4A-1; OsJ_22532; P0596H10.2
• NCBI Protein Information: eukaryotic initiation factor 4A-1
• UniProt Protein Name: Eukaryotic initiation factor 4A-1
• UniProt Gene Name: Os06g0701100
• UniProt Synonym Gene Names: eIF-4A-1

Uniprot Description

ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon ().