ATP-independent RNA helicase dbpA (dbpA) Recombinant Protein | dbpA recombinant protein
Recombinant Escherichia coli ATP-independent RNA helicase dbpA (dbpA)
Gene Names
dbpA; ECK1340; JW1337; rhlC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-independent RNA helicase dbpA (dbpA); Recombinant Escherichia coli ATP-independent RNA helicase dbpA (dbpA); dbpA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-457, full length protein
Sequence
MTAFSTLNVLPPAQLTNLNELGYLTMTPVQAAALPAILAGKDVRVQAKTGSGKTAAFGLGLLQQIDASLFQTQALVLCPTRELADQVAGELRRLARFLPNTKILTLCGGQPFGMQRDSLQHAPHIIVATPGRLLDHLQKGTVSLDALNTLVMDEADRMLDMGFSDAIDDVIRFAPASRQTLLFSATWPEAIAAISGRVQRDPLAIEIDSTDALPPIEQQFYETSSKGKIPLLQRLLSLHQPSSCVVFCNTKKDCQAVCDALNEVGQSALSLHGDLEQRDRDQTLVRFANGSARVLVATDVAARGLDIKSLELVVNFELAWDPEVHVHRIGRTARAGNSGLAISFCAPEEAQRANIISDMLQIKLNWQTPPANSSIATLEAEMATLCIDGGKKAKMRPGDVLGALTGDIGLDGADIGKIAVHPAHVYVAVRQAVAHKAWKQLQGGKIKGKTCRVRLLK
Sequence Length
457
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,188 Da
NCBI Official Full Name
ATP-dependent RNA helicase, specific for 23S rRNA
NCBI Official Symbol
dbpA
NCBI Official Synonym Symbols
ECK1340; JW1337; rhlC
NCBI Protein Information
ATP-dependent RNA helicase, specific for 23S rRNA
UniProt Protein Name
ATP-dependent RNA helicase DbpA
Protein Family
UniProt Gene Name
dbpA
NCBI Description
DbpA is a 3'->5' RNA helicase that is thought to play a role in biogenesis of the 50S subunit of the ribosome . [More information is available at EcoCyc: EG10210].
Uniprot Description
DEAD-box RNA helicase involved in the assembly of the 50S ribosomal subunit. Has an RNA-dependent ATPase activity, which is specific for 23S rRNA, and a 3' to 5' RNA helicase activity that uses the energy of ATP hydrolysis to destabilize and unwind short rRNA duplexes. Requires a single-stranded RNA loading site on the 3' side of the substrate helix.
Research Articles on dbpA
Similar Products
Product Notes
The dbpA dbpa (Catalog #AAA1240209) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-457, full length protein. The amino acid sequence is listed below: MTAFSTLNVL PPAQLTNLNE LGYLTMTPVQ AAALPAILAG KDVRVQAKTG SGKTAAFGLG LLQQIDASLF QTQALVLCPT RELADQVAGE LRRLARFLPN TKILTLCGGQ PFGMQRDSLQ HAPHIIVATP GRLLDHLQKG TVSLDALNTL VMDEADRMLD MGFSDAIDDV IRFAPASRQT LLFSATWPEA IAAISGRVQR DPLAIEIDST DALPPIEQQF YETSSKGKIP LLQRLLSLHQ PSSCVVFCNT KKDCQAVCDA LNEVGQSALS LHGDLEQRDR DQTLVRFANG SARVLVATDV AARGLDIKSL ELVVNFELAW DPEVHVHRIG RTARAGNSGL AISFCAPEEA QRANIISDML QIKLNWQTPP ANSSIATLEA EMATLCIDGG KKAKMRPGDV LGALTGDIGL DGADIGKIAV HPAHVYVAVR QAVAHKAWKQ LQGGKIKGKT CRVRLLK. It is sometimes possible for the material contained within the vial of "ATP-independent RNA helicase dbpA (dbpA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
