Trimeric intracellular cation channel type A (TMEM38A) Recombinant Protein | MG33A recombinant protein
Recombinant Rabbit Trimeric intracellular cation channel type A (TMEM38A)
Gene Names
MG33A; TMEM38A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Trimeric intracellular cation channel type A (TMEM38A); Recombinant Rabbit Trimeric intracellular cation channel type A (TMEM38A); Recombinant Trimeric intracellular cation channel type A (TMEM38A); Trimeric intracellular cation channel type A; TRIC-A; TRICA; Mitsugumin-33A Transmembrane protein 38A; MG33A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-295
Sequence
MELLSALSLGELALSFSRVPLFPVFDLSYFIVSILYLKYEPGAVELSRRHPVASWLCAMLHCFGSYILADLLLGEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKEVVRVRKIAVGIHHAHHHYHHGWFIMIATGWVKGSGVALLSNVEQLLRGVWKPETNEILHMSFPTKASLYGAILFTLQQTRWLPVSKASLIFIFTMFMVSCKVFLTATHSHSSPFDVLEAYVCPVLFGTGSGGDHPQDNHGAWPGGPPSGALATKSKEELSEGSRKKKTKKAD
Sequence Length
295
Species
Oryctolagus cuniculus (Rabbit)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,881 Da
NCBI Official Full Name
trimeric intracellular cation channel type A
NCBI Official Symbol
MG33A
NCBI Official Synonym Symbols
TMEM38A
NCBI Protein Information
trimeric intracellular cation channel type A; TRICA; TRIC-A; mitsugumin-33A; transmembrane protein 38A
UniProt Protein Name
Trimeric intracellular cation channel type A
UniProt Gene Name
TMEM38A
UniProt Synonym Gene Names
MG33A; TRIC-A; TRICA
UniProt Entry Name
TM38A_RABIT
Uniprot Description
Function: Monovalent cation channel required for maintenance of rapid intracellular calcium release. May act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores. Ref.1 UniProtKB Q3TMP8
Subunit structure: Homotrimer. Ref.1
Subcellular location: Sarcoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane Ref.1.
Domain: The second transmembrane domain has been proposed to cross only half of the lipid bilayer and to loop back into the cytosol, so that the domains on each side of this domain are both found on the cytosolic face of the membrane. The cytosolic loop may form an ion-conducting pore
By similarity. UniProtKB Q3TMP8
Sequence similarities: Belongs to the TMEM38 family.
Similar Products
Product Notes
The MG33A tmem38a (Catalog #AAA1237854) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-295. The amino acid sequence is listed below: MELLSALSLG ELALSFSRVP LFPVFDLSYF IVSILYLKYE PGAVELSRRH PVASWLCAML HCFGSYILAD LLLGEPLIDY FSNNSSILLA SAVWYLIFFC PLDLFYKCVC FLPVKLIFVA MKEVVRVRKI AVGIHHAHHH YHHGWFIMIA TGWVKGSGVA LLSNVEQLLR GVWKPETNEI LHMSFPTKAS LYGAILFTLQ QTRWLPVSKA SLIFIFTMFM VSCKVFLTAT HSHSSPFDVL EAYVCPVLFG TGSGGDHPQD NHGAWPGGPP SGALATKSKE ELSEGSRKKK TKKAD. It is sometimes possible for the material contained within the vial of "Trimeric intracellular cation channel type A (TMEM38A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
