Western Blot (WB)
(Western blot-VGLL1 Polyclonal Antibody)
Rabbit anti-Mouse, Rat VGLL1 Polyclonal Antibody | anti-VGLL1 antibody
VGLL1 Polyclonal Antibody
Gene Names
VGLL1; TDU; VGL1
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
VGLL1; Polyclonal Antibody; VGLL1 Polyclonal Antibody; TDU; VGL1; vestigial like family member 1; anti-VGLL1 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.06 mg/ml (varies by lot)
Sequence Length
258
Applicable Applications for anti-VGLL1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 59-258 of human VGLL1 (NP_057351.1).
Immunogen Sequence
TPSSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAANCNLHVPGPMAVNQFSPSLARRASVRPGELWHFSSLAGTSSLEPGYSHPFPARHLVPEPQPDGKREPLLSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGHPHRYLQHL
Positive Samples
Mouse Brain, Rat Brain
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-VGLL1 Polyclonal Antibody)
Western Blot (WB)
(Western blot-VGLL1 Polyclonal Antibody)
Related Product Information for anti-VGLL1 antibody
The protein encoded by this gene binds proteins of the TEA domain family of transcription factors (TEFs) through the Vg (vestigial) homology region found in its N-terminus. It may thus function as a specific coactivator for the mammalian TEFs.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 28kDa
Observed: 29kDa
Observed: 29kDa
NCBI Official Full Name
transcription cofactor vestigial-like protein 1
NCBI Official Synonym Full Names
vestigial like family member 1
NCBI Official Symbol
VGLL1
NCBI Official Synonym Symbols
TDU; VGL1
NCBI Protein Information
transcription cofactor vestigial-like protein 1
UniProt Protein Name
Transcription cofactor vestigial-like protein 1
Protein Family
UniProt Gene Name
VGLL1
UniProt Synonym Gene Names
TDU; Vgl-1
UniProt Entry Name
VGLL1_HUMAN
NCBI Description
The protein encoded by this gene binds proteins of the TEA domain family of transcription factors (TEFs) through the Vg (vestigial) homology region found in its N-terminus. It may thus function as a specific coactivator for the mammalian TEFs. [provided by RefSeq, Sep 2009]
Research Articles on VGLL1
Similar Products
Product Notes
The VGLL1 vgll1 (Catalog #AAA9140548) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VGLL1 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's VGLL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the VGLL1 vgll1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VGLL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
