SDS-Page
Methyl-accepting chemotaxis protein I (tsr) Recombinant Protein | tsr recombinant protein
Recombinant Escherichia coli Methyl-accepting chemotaxis protein I (tsr), partial
Gene Names
tsr; cheD; ECK4345; JW4318
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Methyl-accepting chemotaxis protein I (tsr); Recombinant Escherichia coli Methyl-accepting chemotaxis protein I (tsr); partial; tsr recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
211-551aa; Partial
Sequence
WFGIKASLVAPMNRLIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQQQQRETSAVVKTVTPAAPRKMAVADSEENWETF
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38 kDa
NCBI Official Full Name
methyl-accepting chemotaxis protein I, serine sensor receptor
NCBI Official Symbol
tsr
NCBI Official Synonym Symbols
cheD; ECK4345; JW4318
NCBI Protein Information
methyl-accepting chemotaxis protein I, serine sensor receptor
UniProt Protein Name
Methyl-accepting chemotaxis protein I
Protein Family
UniProt Gene Name
tsr
UniProt Synonym Gene Names
cheD; MCP-I
NCBI Description
Tsr also senses energy levels and is involved in aerotaxis, redox taxis and glycerol repellent taxis. [More information is available at EcoGene: EG11034]. Tsr is a serine chemoreceptor in Escherichia coli and binds directly to the MCP periplasmic domain. [More information is available at EcoCyc: EG11034].
Uniprot Description
Receptor for the attractant L-serine and related amino acids. Is also responsible for chemotaxis away from a wide range of repellents, including leucine, indole, and weak acids.
Research Articles on tsr
Similar Products
Product Notes
The tsr tsr (Catalog #AAA1236827) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 211-551aa; Partial. The amino acid sequence is listed below: WFGIKASLVA PMNRLIDSIR HIAGGDLVKP IEVDGSNEMG QLAESLRHMQ GELMRTVGDV RNGANAIYSG ASEIATGNND LSSRTEQQAA SLEETAASME QLTATVKQNA ENARQASHLA LSASETAQRG GKVVDNVVQT MRDISTSSQK IADIISVIDG IAFQTNILAL NAAVEAARAG EQGRGFAVVA GEVRNLAQRS AQAAREIKSL IEDSVGKVDV GSTLVESAGE TMAEIVSAVT RVTDIMGEIA SASDEQSRGI DQVGLAVAEM DRVTQQNAAL VEESAAAAAA LEEQASRLTE AVAVFRIQQQ QRETSAVVKT VTPAAPRKMA VADSEENWET F . It is sometimes possible for the material contained within the vial of "Methyl-accepting chemotaxis protein I (tsr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
