Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative gustatory receptor 36a (Gr36a) Recombinant Protein | Gr36a recombinant protein

Recombinant Drosophila melanogaster Putative gustatory receptor 36a (Gr36a)

Gene Names
Gr36a; CG31747; DmelCG31747; Gr36B1; GRLU.1; GrLU1; LU.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative gustatory receptor 36a (Gr36a); Recombinant Drosophila melanogaster Putative gustatory receptor 36a (Gr36a); Recombinant Putative gustatory receptor 36a (Gr36a); Putative gustatory receptor 36a; Gr36a recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-391
Sequence
MFDWVGLLLKVLYYYGQIIGLINFEIDWQRGRVVAAQRGILFAIAINVLICMVLLLQISKKFNLDVYFGRANQLHQYVIIVMVSLRMASGISAILNRWRQRAQLMRLVECVLRLFLKKPHVKQMSRWAILVKFSVGVVSNFLQMAISMESLDRLGFNEFVGMASDFWMSAIINMAISQHYLVILFVRAYYHLLKTEVRQAIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQNQLQSIVTQLNQVFGIQGIMVYGGYYIFSVATTYITYSLAINGIEELHLSVRAAALVFSWFLFYYTSAILNLFVMLKLFDDHKEMERILEERTLFTSALDVRLEQSFESIQLQLIRNPLKIEVLDIFTITRSSSAAMIGSIITNSIFLIQYDMEYF
Sequence Length
391
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,373 Da
NCBI Official Full Name
gustatory receptor 36a
NCBI Official Synonym Full Names
Gustatory receptor 36a
NCBI Official Symbol
Gr36a
NCBI Official Synonym Symbols
CG31747; DmelCG31747; Gr36B1; GRLU.1; GrLU1; LU.1
NCBI Protein Information
CG31747 gene product from transcript CG31747-RA; CG31747-PA; Gr36a-PA; gustatory receptor 36a; gustatory receptor LU.1
UniProt Protein Name
Putative gustatory receptor 36a
UniProt Gene Name
Gr36a
UniProt Entry Name
GR36A_DROME

Uniprot Description

Function: Probable role in the gustatory response.

Subcellular location: Cell membrane; Multi-pass membrane protein

Potential.

Tissue specificity: Expressed in the adult labellar chemosensory neurons.

Sequence similarities: Belongs to the G-protein coupled receptor Dr-tr family. Type VI subfamily.

Similar Products

Product Notes

The Gr36a gr36a (Catalog #AAA1232556) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-391. The amino acid sequence is listed below: MFDWVGLLLK VLYYYGQIIG LINFEIDWQR GRVVAAQRGI LFAIAINVLI CMVLLLQISK KFNLDVYFGR ANQLHQYVII VMVSLRMASG ISAILNRWRQ RAQLMRLVEC VLRLFLKKPH VKQMSRWAIL VKFSVGVVSN FLQMAISMES LDRLGFNEFV GMASDFWMSA IINMAISQHY LVILFVRAYY HLLKTEVRQA IHESQMLSEI YPRRAAFMTK CCYLADRIDN IAKLQNQLQS IVTQLNQVFG IQGIMVYGGY YIFSVATTYI TYSLAINGIE ELHLSVRAAA LVFSWFLFYY TSAILNLFVM LKLFDDHKEM ERILEERTLF TSALDVRLEQ SFESIQLQLI RNPLKIEVLD IFTITRSSSA AMIGSIITNS IFLIQYDMEY F. It is sometimes possible for the material contained within the vial of "Putative gustatory receptor 36a (Gr36a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.