Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Wee1-like protein kinase (wee) Recombinant Protein | wee recombinant protein

Recombinant Drosophila melanogaster Wee1-like protein kinase (wee)

Gene Names
wee; CG4488; DmelCG4488; Dwee; dwee1; dWee1; Dwee1; Wee; Wee 1; wee1; Wee1; WEE1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Wee1-like protein kinase (wee); Recombinant Drosophila melanogaster Wee1-like protein kinase (wee); Recombinant Wee1-like protein kinase (wee); Wee1-like protein kinase; Dwee1 EC= 2.7.10.2; wee recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-609
Sequence
MAFRQSEHEMSVTSLDSSVELRSRSPSPQVFNPRKLRFADDDFDKDTPEGASPQHPLQQRPKLSSGEEQQLDSKIGKEGGDGDVSMSPPCQKVRALRLFSTPATPKTILQKSTTQCSNHLSAAAAAVNASRRSDDLFRLSERPRSLPLHNRKLPTQDTANVNPFTPDSLMAHNKKRCRTQFGRENLNLNVNAMQKYLLSDACDDDVTEEAGDSMREIHQQAPKRLALHDTNISRFKREFMQVNVIGVGEFGVVFQCVNRLDGCIYAIKKSKKPVAGSSFEKRALNEVWAHAVLGKHDNVVRYYSAWAEDDHMLIQNEFCDGGSLHARIQDHCLGEAELKIVLMHVIEGLRYIHSNDLVHMDLKPENIFSTMNPNAHKLVEVQPQQTKDDDGMDSVYEELRHSENLVTYKIGDLGHVTSVKEPYVEEGDCRYLPKEILHEDYSNLFKADIFSLGITLFEAAGGGPLPKNGPEWHNLRDGKVPILPSLSRDFNELIAQMMHPYPDKRPTSQSIFSHPILSAVDSKSKLQLGLELTVEKRKNEILMNKLREAKKQIKLLEQRVNLLAVTNNPDSLDGQRCLRSFTRRMRTPFSSHGKFDSISDRNKNVITNI
Sequence Length
609
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68,809 Da
NCBI Official Full Name
wee
NCBI Official Symbol
wee
NCBI Official Synonym Symbols
CG4488; DmelCG4488; Dwee; dwee1; dWee1; Dwee1; Wee; Wee 1; wee1; Wee1; WEE1
NCBI Protein Information
CG4488 gene product from transcript CG4488-RA; CG4488-PA; wee; wee-PA
UniProt Protein Name
Wee1-like protein kinase
UniProt Gene Name
wee
UniProt Synonym Gene Names
Dwee1
UniProt Entry Name
WEE1_DROME

Uniprot Description

Function: Could act as a negative regulator of entry into mitosis (G2 to M transition). This kinase specifically phosphorylates and inactivates cyclin B1-complexed CDC2. Ref.1

Catalytic activity: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Cofactor: Binds 2 magnesium ions per subunit

By similarity.

Enzyme regulation: Negatively regulated by phosphorylation in the M-phase.

Subcellular location: Nucleus

By similarity.

Tissue specificity: Expressed in embryos; expression remains high in the proliferating cells of the central nervous system well after cells in the rest of the embryo have ceased dividing. Ref.1

Developmental stage: Expressed both maternally and zygotically during postblastoderm divisions of embryogenesis. Ref.1

Post-translational modification: Phosphorylated during M and G1 phases

By similarity.

Sequence similarities: Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WEE1 subfamily.Contains 1 protein kinase domain.

Research Articles on wee

Similar Products

Product Notes

The wee wee (Catalog #AAA1219473) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-609. The amino acid sequence is listed below: MAFRQSEHEM SVTSLDSSVE LRSRSPSPQV FNPRKLRFAD DDFDKDTPEG ASPQHPLQQR PKLSSGEEQQ LDSKIGKEGG DGDVSMSPPC QKVRALRLFS TPATPKTILQ KSTTQCSNHL SAAAAAVNAS RRSDDLFRLS ERPRSLPLHN RKLPTQDTAN VNPFTPDSLM AHNKKRCRTQ FGRENLNLNV NAMQKYLLSD ACDDDVTEEA GDSMREIHQQ APKRLALHDT NISRFKREFM QVNVIGVGEF GVVFQCVNRL DGCIYAIKKS KKPVAGSSFE KRALNEVWAH AVLGKHDNVV RYYSAWAEDD HMLIQNEFCD GGSLHARIQD HCLGEAELKI VLMHVIEGLR YIHSNDLVHM DLKPENIFST MNPNAHKLVE VQPQQTKDDD GMDSVYEELR HSENLVTYKI GDLGHVTSVK EPYVEEGDCR YLPKEILHED YSNLFKADIF SLGITLFEAA GGGPLPKNGP EWHNLRDGKV PILPSLSRDF NELIAQMMHP YPDKRPTSQS IFSHPILSAV DSKSKLQLGL ELTVEKRKNE ILMNKLREAK KQIKLLEQRV NLLAVTNNPD SLDGQRCLRS FTRRMRTPFS SHGKFDSISD RNKNVITNI. It is sometimes possible for the material contained within the vial of "Wee1-like protein kinase (wee), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.