Angiopoietin-2 (ANGPT2) Recombinant Protein | ANGPT2 recombinant protein
Recombinant Human Angiopoietin-2 (ANGPT2), partial
Gene Names
ANGPT2; ANG2; AGPT2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Angiopoietin-2 (ANGPT2); Recombinant Human Angiopoietin-2 (ANGPT2); partial; ANGPT2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-485aa, Full Length of Mature Protein
Sequence
YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLK
Sequence Length
495
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ANGPT2 recombinant protein
This protein is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene.
Product Categories/Family for ANGPT2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
55.7 kDa
NCBI Official Full Name
angiopoietin-2 isoform b
NCBI Official Synonym Full Names
angiopoietin 2
NCBI Official Symbol
ANGPT2
NCBI Official Synonym Symbols
ANG2; AGPT2
NCBI Protein Information
angiopoietin-2
UniProt Protein Name
Angiopoietin-2
Protein Family
UniProt Gene Name
ANGPT2
UniProt Synonym Gene Names
ANG-2
NCBI Description
The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
Research Articles on ANGPT2
Similar Products
Product Notes
The ANGPT2 angpt2 (Catalog #AAA1205114) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-485aa, Full Length of Mature Protein. The amino acid sequence is listed below: YNNFRKSMDS IGKKQYQVQH GSCSYTFLLP EMDNCRSSSS PYVSNAVQRD APLEYDDSVQ RLQVLENIME NNTQWLMKLE NYIQDNMKKE MVEIQQNAVQ NQTAVMIEIG TNLLNQTAEQ TRKLTDVEAQ VLNQTTRLEL QLLEHSLSTN KLEKQILDQT SEINKLQDKN SFLEKKVLAM EDKHIIQLQS IKEEKDQLQV LVSKQNSIIE ELEKKIVTAT VNNSVLQKQQ HDLMETVNNL LTMMSTSNSA KDPTVAKEEQ ISFRDCAEVF KSGHTTNGIY TLTFPNSTEE IKAYCDMEAG GGGWTIIQRR EDGSVDFQRT WKEYKVGFGN PSGEYWLGNE FVSQLTNQQR YVLKIHLKDW EGNEAYSLYE HFYLSSEELN YRIHLKGLTG TAGKISSISQ PGNDFSTKDG DNDKCICKCS QMLTGGWWFD ACGPSNLNGM YYPQRQNTNK FNGIKWYYWK GSGYSLK. It is sometimes possible for the material contained within the vial of "Angiopoietin-2 (ANGPT2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
