Chymase (CMA1) Recombinant Protein | CMA1 recombinant protein
Recombinant Guinea pig Chymase (CMA1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chymase (CMA1); Recombinant Guinea pig Chymase (CMA1); CMA1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-247, Full length protein
Sequence
VIGGTECKPHSRPYMAYLEIVSSEGYEKDCGGFLIRRNFVLTAAHCAGRSLTVNLGVHNKKMKEDTWQRLKVIKQFLHPNYNSSVLLHDIMLLKLEKKANLTLAVGTLPLPPECNFLTSGRMCRAAGWGRTNVEEPASDTLQEVKLRLMDPQACKHFPNFNHNLQLCVGNPRKRKSVFKGDSGGPLLCAGIAQGIVSYAHRNAKPPVVFTRISHYRPWINKILKAN
Sequence Length
226
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CMA1 recombinant protein
This gene product is a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Angiotensin II has been implicated in blood pressure control and in the pathogenesis of hypertension, cardiac hypertrophy, and heart failure. Thus, this gene product is a target for cardiovascular disease therapies. This gene maps to 14q11.2 in a cluster of genes encoding other proteases.
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,666 Da
NCBI Official Full Name
chymase
UniProt Protein Name
Chymase
Protein Family
UniProt Gene Name
CMA1
Uniprot Description
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
Similar Products
Product Notes
The CMA1 cma1 (Catalog #AAA1195941) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-247, Full length protein. The amino acid sequence is listed below: VIGGTECKPH SRPYMAYLEI VSSEGYEKDC GGFLIRRNFV LTAAHCAGRS LTVNLGVHNK KMKEDTWQRL KVIKQFLHPN YNSSVLLHDI MLLKLEKKAN LTLAVGTLPL PPECNFLTSG RMCRAAGWGR TNVEEPASDT LQEVKLRLMD PQACKHFPNF NHNLQLCVGN PRKRKSVFKG DSGGPLLCAG IAQGIVSYAH RNAKPPVVFT RISHYRPWIN KILKAN. It is sometimes possible for the material contained within the vial of "Chymase (CMA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
