Spore wall protein 30 (SWP30) Recombinant Protein | SWP30 recombinant protein
Recombinant Nosema bombycis Spore wall protein 30 (SWP30)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Spore wall protein 30 (SWP30); Recombinant Nosema bombycis Spore wall protein 30 (SWP30); Recombinant Spore wall protein 30 (SWP30); Spore wall protein 30; SWP30 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-278aa; full length protein
Sequence
EPTRHHDRYAYIERVVCDVNFPDLLCRRKSHAIAYRMFRLIPVRNPNYEISTDYVSHEFN TTRVRSESEKYLCSSYGPNGYVSGDVFILRNALNKLFDHHEIEELAYELFIRLVASFLDS CSYPKSFEHNLVRCRSEDEELCTSPLAAFIKLVSRRSTRDVVLIVLNDFSHYLKLEEGHG FSKDRKSNQCVKFTQLYFYYLSAAVNFIERKISAFTLIPVMDDRRIASVSAIMISSKFAN TTGNYVINATSFMDNTIPF
Sequence Length
278
Species
Nosema bombycis (Microsporidian parasite)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
32,094 Da
UniProt Protein Name
Spore wall protein 30
UniProt Gene Name
SWP30
UniProt Synonym Gene Names
HSWP1
UniProt Entry Name
SWP30_NOSBO
Uniprot Description
Subcellular location: Spore wall Ref.1.
Developmental stage: Synthesized during sporogony. Ref.1
Similar Products
Product Notes
The Spore wall protein 30 (SWP30) swp30 (Catalog #AAA1187484) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-278aa; full length protein. The amino acid sequence is listed below: EPTRHHDRYA YIERVVCDVN FPDLLCRRKS HAIAYRMFRL IPVRNPNYEI STDYVSHEFN TTRVRSESEK YLCSSYGPNG YVSGDVFILR NALNKLFDHH EIEELAYELF IRLVASFLDS CSYPKSFEHN LVRCRSEDEE LCTSPLAAFI KLVSRRSTRD VVLIVLNDFS HYLKLEEGHG FSKDRKSNQC VKFTQLYFYY LSAAVNFIER KISAFTLIPV MDDRRIASVS AIMISSKFAN TTGNYVINAT SFMDNTIPF. It is sometimes possible for the material contained within the vial of "Spore wall protein 30 (SWP30), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
