Small-conductance mechanosensitive channel (mscS) Recombinant Protein | mscS recombinant protein

Recombinant Escherichia coli Small-conductance mechanosensitive channel (mscS)

• Gene Names: mscS; ECK2920; JW2891; yggB
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Small-conductance mechanosensitive channel (mscS); Recombinant Escherichia coli Small-conductance mechanosensitive channel (mscS); Recombinant Small-conductance mechanosensitive channel (mscS); Small-conductance mechanosensitive channel; mscS recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-286
• Sequence: MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA
• Sequence Length: 286

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 16130825
• NCBI GeneID: 947416
• NCBI Accession #: NP_417399.1
• NCBI GenBank Nucleotide #: NC_000913.2
• UniProt Accession #: P0C0S1; P11666; Q2M9R8
• Molecular Weight: 30,896 Da
• NCBI Official Full Name: mechanosensitive channel protein, small conductance
• NCBI Official Symbol: mscS
• NCBI Official Synonym Symbols: ECK2920; JW2891; yggB
• NCBI Protein Information: mechanosensitive channel protein, small conductance
• UniProt Protein Name: Small-conductance mechanosensitive channel
• Protein Family: Small-conductance mechanosensitive channel
• UniProt Gene Name: mscS
• UniProt Synonym Gene Names: yggB
• UniProt Entry Name: MSCS_ECOLI

NCBI Description

HT_Cmplx47_Mem: [More information is available at EcoGene: EG11160]. MscS is one of four classes of Escherichia coli mechanosensitive (MS) channels. [More information is available at EcoCyc: EG11160].

Uniprot Description

Function: Mechanosensitive channel that participates in the regulation of osmotic pressure changes within the cell, opening in response to stretch forces in the membrane lipid bilayer, without the need for other proteins. Forms an ion channel of 1.0 nanosiemens conductance with a slight preference for anions. The channel is sensitive to voltage; as the membrane is depolarized, less tension is required to open the channel and vice versa. The channel is characterized by short bursts of activity that last for a few seconds.The channel pore is formed by TM3 and the loop between TM2 and TM3. After a sharp turn at Gly-113, an alpha-helix (residues 114-127) is oriented nearly parallel to the plane of the putative lipid bilayer. On the intracellular side of the channel, the permeation pathway of MscS does not connect directly to the cytoplasm but instead opens to a large chamber that is connected to the cytoplasm. This chamber resembles a molecular filter that could serve to prescreen large molecules before they are allowed passage to the transmembrane pore. The TM1 and TM2 helices appear to be likely candidates for mediating the tension and voltage sensitivities of MscS. Gating requires large rearrangements of at least the C-terminus.

Subunit structure: Homoheptamer. Ref.10 Ref.12 Ref.15

Subcellular location: Cell inner membrane; Multi-pass membrane protein Ref.12.

Sequence similarities: Belongs to the MscS (TC 1.A.23) family. [View classification]