Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Preprotein translocase subunit SECE1 (SECE1) Recombinant Protein | AT4G14870 recombinant protein

Recombinant Arabidopsis thaliana Preprotein translocase subunit SECE1 (SECE1)

Gene Names
AT4G14870; DL3475W; FCAALL.408
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Preprotein translocase subunit SECE1 (SECE1); Recombinant Arabidopsis thaliana Preprotein translocase subunit SECE1 (SECE1); Recombinant Preprotein translocase subunit SECE1 (SECE1); Preprotein translocase subunit SECE1; AT4G14870 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
39-177
Sequence
TMTTSNLRKSACFVAKAIEQRRDTAGSESESEATPSPAEESGSGEDKEVEISAIGAEIKAAMEQRKTAEEEKGKNEFLSGVAEEVKEIEWPAFQKVLGTTGVVLGVIAGSSVVLLTVNFLLAELSDRVFIGRGVQDFFS
Sequence Length
177
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,121 Da
NCBI Official Full Name
secE/sec61-gamma protein transport protein
NCBI Official Symbol
AT4G14870
NCBI Official Synonym Symbols
DL3475W; FCAALL.408
NCBI Protein Information
secE/sec61-gamma protein transport protein
UniProt Protein Name
Preprotein translocase subunit SECE1
UniProt Gene Name
SECE1
UniProt Entry Name
SECE1_ARATH

Uniprot Description

Function: Involved in the import/insertion pathway in the thylakoids. The signal recognition particle is not involved in the insertion of SECE1 in the thylakoid membrane. Ref.6 Ref.9

Subunit structure: Part of the Sec protein translocation apparatus. Interacts with SCY1 and ALB3. Ref.5 Ref.8

Subcellular location: Plastid › chloroplast thylakoid membrane; Single-pass membrane protein Ref.5 Ref.7.

Disruption phenotype: Seedling lethal. Albino seedlings with yellow and translucent (glassy) lateral organs when grown heterotrophically. Ref.9

Sequence similarities: Belongs to the SecE/SEC61-gamma family.

Similar Products

Product Notes

The AT4G14870 sece1 (Catalog #AAA1172354) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 39-177. The amino acid sequence is listed below: TMTTSNLRKS ACFVAKAIEQ RRDTAGSESE SEATPSPAEE SGSGEDKEVE ISAIGAEIKA AMEQRKTAEE EKGKNEFLSG VAEEVKEIEW PAFQKVLGTT GVVLGVIAGS SVVLLTVNFL LAELSDRVFI GRGVQDFFS. It is sometimes possible for the material contained within the vial of "Preprotein translocase subunit SECE1 (SECE1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.