Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Actin-related protein 2/3 complex subunit 3 (ARPC3) Recombinant Protein | ARPC3 recombinant protein

Recombinant Human Actin-related protein 2/3 complex subunit 3 (ARPC3)

Gene Names
ARPC3; ARC21; p21-Arc
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Actin-related protein 2/3 complex subunit 3 (ARPC3); Recombinant Human Actin-related protein 2/3 complex subunit 3 (ARPC3); ARPC3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-178, Full length protein
Sequence
PAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
Sequence Length
177
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ARPC3 recombinant protein
This gene encodes one of seven subunits of the human Arp2
3 protein complex. The Arp2
3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of This protein, the p21 subunit, has yet to be determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,547 Da
NCBI Official Full Name
actin-related protein 2/3 complex subunit 3 isoform 1
NCBI Official Synonym Full Names
actin related protein 2/3 complex subunit 3
NCBI Official Symbol
ARPC3
NCBI Official Synonym Symbols
ARC21; p21-Arc
NCBI Protein Information
actin-related protein 2/3 complex subunit 3
UniProt Protein Name
Actin-related protein 2/3 complex subunit 3
UniProt Gene Name
ARPC3
UniProt Synonym Gene Names
ARC21; p21-ARC

NCBI Description

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2013]

Uniprot Description

Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Research Articles on ARPC3

Similar Products

Product Notes

The ARPC3 arpc3 (Catalog #AAA1169506) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-178, Full length protein. The amino acid sequence is listed below: PAYHSSLMDP DTKLIGNMAL LPIRSQFKGP APRETKDTDI VDEAIYYFKA NVFFKNYEIK NEADRTLIYI TLYISECLKK LQKCNSKSQG EKEMYTLGIT NFPIPGEPGF PLNAIYAKPA NKQEDEVMRA YLQQLRQETG LRLCEKVFDP QNDKPSKWWT CFVKRQFMNK SLSGPGQ. It is sometimes possible for the material contained within the vial of "Actin-related protein 2/3 complex subunit 3 (ARPC3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.