Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytochrome b-c1 complex subunit 9 (qcr9) Recombinant Protein | qcr9 recombinant protein

Recombinant Schizosaccharomyces pombe Cytochrome b-c1 complex subunit 9 (qcr9)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b-c1 complex subunit 9 (qcr9); Recombinant Schizosaccharomyces pombe Cytochrome b-c1 complex subunit 9 (qcr9); Recombinant Cytochrome b-c1 complex subunit 9 (qcr9); Cytochrome b-c1 complex subunit 9; Complex III subunit 9 Cytochrome c1 non-heme 7.3 kDa protein Ubiquinol-cytochrome c reductase complex 7.3 kDa protein; qcr9 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-67
Sequence
MASSTIYNIFFRRNSSFYATIFVSAFFAKIGFDVFTDSVWKRANAGLTWDEVKPRFLNKDEDAEDDE
Sequence Length
67
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
7,800 Da
NCBI Official Full Name
Cytochrome b-c1 complex subunit 9
UniProt Protein Name
Cytochrome b-c1 complex subunit 9
Protein Family
UniProt Gene Name
qcr9
UniProt Entry Name
QCR9_SCHPO

Uniprot Description

Function: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. Qcr9 is required for formation of a fully functional complex

By similarity.

Subunit structure: Fungal bc1 complex contains 10 subunits; 3 respiratory subunits, 2 core proteins and 5 low-molecular weight proteins

By similarity.

Subcellular location: Mitochondrion inner membrane

By similarity.

Sequence similarities: Belongs to the UQCR10/QCR9 family.

Sequence caution: The sequence CAA20667.1 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The Cytochrome b-c1 complex subunit 9 (qcr9) qcr9 (Catalog #AAA1159514) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-67. The amino acid sequence is listed below: MASSTIYNIF FRRNSSFYAT IFVSAFFAKI GFDVFTDSVW KRANAGLTWD EVKPRFLNKD EDAEDDE. It is sometimes possible for the material contained within the vial of "Cytochrome b-c1 complex subunit 9 (qcr9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.