Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Cytochrome b-c1 complex subunit 9 (UQCR10) Recombinant Protein | UQCR10 recombinant protein

Recombinant Human Cytochrome b-c1 complex subunit 9 (UQCR10)

Gene Names
UQCR10; QCR9; UCRC; HSPC051; HSPC119; HSPC151; UCCR7.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b-c1 complex subunit 9 (UQCR10); Recombinant Human Cytochrome b-c1 complex subunit 9 (UQCR10); Cytochrome b-c1 complex subunit 9; Complex III subunit 9; Complex III subunit X; Cytochrome c1 non-heme 7 kDa protein; Ubiquinol-cytochrome c reductase complex 7.2 kDa protein; UQCR10 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-63aa; Full Length
Sequence
AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Sequence Length
62
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for UQCR10 recombinant protein
This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1
Product Categories/Family for UQCR10 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.2 kDa
NCBI Official Full Name
cytochrome b-c1 complex subunit 9 isoform b
NCBI Official Synonym Full Names
ubiquinol-cytochrome c reductase, complex III subunit X
NCBI Official Symbol
UQCR10
NCBI Official Synonym Symbols
QCR9; UCRC; HSPC051; HSPC119; HSPC151; UCCR7.2
NCBI Protein Information
cytochrome b-c1 complex subunit 9; cytochrome C1, nonheme 7kDa protein; cytochrome c1 non-heme 7 kDa protein; ubiquinol-cytochrome c reductase complex (7.2 kD); ubiquinol-cytochrome c reductase complex 7.2 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit X, 7.2kDa
UniProt Protein Name
Cytochrome b-c1 complex subunit 9
UniProt Gene Name
UQCR10
UniProt Synonym Gene Names
UCRC
UniProt Entry Name
QCR9_HUMAN

NCBI Description

UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).[supplied by OMIM, Mar 2008]

Uniprot Description

UCRC iso3: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1. Belongs to the UQCR10/QCR9 family. The bc1 complex contains 11 subunits: 3 respiratory subunits (cytochrome b, cytochrome c1 and Rieske/UQCRFS1), 2 core proteins (UQCRC1/QCR1 and UQCRC2/QCR2) and 6 low-molecular weight proteins (UQCRH/QCR6, UQCRB/QCR7, UQCRQ/QCR8, UQCR10/QCR9, UQCR11/QCR10 and a cleavage product of Rieske/UQCRFS1).

Protein type: Energy Metabolism - oxidative phosphorylation; Mitochondrial

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: mitochondrial inner membrane; mitochondrial respiratory chain complex III

Molecular Function: ubiquinol-cytochrome-c reductase activity

Biological Process: cellular metabolic process; mitochondrial electron transport, ubiquinol to cytochrome c

Research Articles on UQCR10

Similar Products

Product Notes

The UQCR10 uqcr10 (Catalog #AAA1324972) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-63aa; Full Length. The amino acid sequence is listed below: AAATLTSKLY SLLFRRTSTF ALTIIVGVMF FERAFDQGAD AIYDHINEGK LWKHIKHKYE NK. It is sometimes possible for the material contained within the vial of "Cytochrome b-c1 complex subunit 9 (UQCR10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.