Calreticulin (Calr) Recombinant Protein | Calr recombinant protein

Recombinant Rat Calreticulin (Calr)

Cat. Num. AAA1152332

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Calreticulin (Calr); Recombinant Rat Calreticulin (Calr); Calr recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 18-416, full length protein
• Sequence: DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDEDDRDEDEDEEDEKEEDEEDATGQAKDEL
• Sequence Length: 399

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Calr recombinant protein

Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro
SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium. The amino terminus of calreticulin interacts with the DNA-binding domain of the glucocorticoid receptor and prevents the receptor from binding to its specific glucocorticoid response element. Calreticulin can inhibit the binding of androgen receptor to its hormone-responsive DNA element and can inhibit androgen receptor and retinoic acid receptor transcriptional activities in vivo, as well as retinoic acid-induced neuronal differentiation. Thus, calreticulin can act as an important modulator of the regulation of gene transcription by nuclear hormone receptors. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin but calreticulin is not a Ro
SS-A antigen. Earlier papers referred to calreticulin as an Ro
SS-A antigen but this was later disproven. Increased autoantibody titer against human calreticulin is found in infants with complete congenital heart block of both the IgG and IgM classes.

NCBI and Uniprot Product Information

• NCBI GI #: 11693172
• NCBI GeneID: 64202
• NCBI Accession #: NP_071794.1
• NCBI GenBank Nucleotide #: NM_022399.2
• UniProt Accession #: P18418; P10452
• Molecular Weight: 47,995 Da
• NCBI Official Full Name: calreticulin
• NCBI Official Synonym Full Names: calreticulin
• NCBI Official Symbol: Calr
• NCBI Protein Information: calreticulin
• UniProt Protein Name: Calreticulin
• UniProt Gene Name: Calr
• UniProt Synonym Gene Names: CABP3; ERp60

NCBI Description

Ca(2+)-binding molecular chaperone that promotes folding of proteins carrying N-linked glycans [RGD, Feb 2006]

Uniprot Description

Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis.