GTP-binding protein Di-Ras3 (DIRAS3) Recombinant Protein | DIRAS3 recombinant protein

Recombinant Human GTP-binding protein Di-Ras3 (DIRAS3)

Cat. Num. AAA1147197

• Gene Names: DIRAS3; ARHI; NOEY2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: GTP-binding protein Di-Ras3 (DIRAS3); Recombinant Human GTP-binding protein Di-Ras3 (DIRAS3); GTP-binding protein Di-Ras3; Distinct subgroup of the Ras family member 3; Rho-related GTP-binding protein RhoI; DIRAS3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-229aa; Full Length
• Sequence: MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKC
• Sequence Length: 226

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for DIRAS3 recombinant protein

DIRAS3; ARHI, NOEY2, RHOI

NCBI and Uniprot Product Information

• NCBI GI #: 4757772
• NCBI GeneID: 9077
• NCBI Accession #: NP_004666.1
• NCBI GenBank Nucleotide #: NM_004675.2
• UniProt Accession #: O95661; B3KMP3
• Molecular Weight: 52.5 kDa
• NCBI Official Full Name: GTP-binding protein Di-Ras3
• NCBI Official Synonym Full Names: DIRAS family, GTP-binding RAS-like 3
• NCBI Official Symbol: DIRAS3
• NCBI Official Synonym Symbols: ARHI; NOEY2
• NCBI Protein Information: GTP-binding protein Di-Ras3; ras homolog gene family, member I; rho-related GTP-binding protein RhoI; distinct subgroup of the Ras family member 3
• UniProt Protein Name: GTP-binding protein Di-Ras3
• Protein Family: GTP-binding protein
• UniProt Gene Name: DIRAS3
• UniProt Synonym Gene Names: ARHI; NOEY2; RHOI
• UniProt Entry Name: DIRA3_HUMAN

NCBI Description

This gene is a member of the ras superfamily, and is expressed in normal ovarian and breast epithelial cells, but not in ovarian and breast cancers. It is an imprinted gene, with monoallelic expression of the paternal allele, which is associated with growth suppression. Thus, this gene appears to be a putative tumor suppressor gene whose function is abrogated in ovarian and breast cancers. [provided by RefSeq, Oct 2010]

Uniprot Description

DIRAS3: a member of the ras superfamily, and is expressed in normal ovarian and breast epithelial cells, but not in ovarian and breast cancers. It is an imprinted gene, with monoallelic expression of the paternal allele, which is associated with growth suppression. Thus, this gene appears to be a putative tumor suppressor gene whose function is abrogated in ovarian and breast cancers. [provided by RefSeq, Oct 2010]

Protein type: G protein; G protein, monomeric, di-Ras; G protein, monomeric

Chromosomal Location of Human Ortholog: 1p31

Cellular Component: plasma membrane

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: genetic imprinting; small GTPase mediated signal transduction; regulation of cyclin-dependent protein kinase activity