Plasma serine protease inhibitor (SERPINA5) Recombinant Protein | SERPINA5 recombinant protein

Recombinant Human Plasma serine protease inhibitor (SERPINA5)

Cat. Num. AAA1131463

• Gene Names: SERPINA5; PCI; PAI3; PAI-3; PCI-B; PROCI; PLANH3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Plasma serine protease inhibitor (SERPINA5); Recombinant Human Plasma serine protease inhibitor (SERPINA5); SERPINA5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 26-406, Full length protein
• Sequence: EMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP
• Sequence Length: 381

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 194018472
• NCBI GeneID: 5104
• NCBI Accession #: NP_000615.3
• NCBI GenBank Nucleotide #: NM_000624.5
• UniProt Accession #: P05154; Q07616; Q9UG30
• Molecular Weight: 45,675 Da
• NCBI Official Full Name: plasma serine protease inhibitor preproprotein
• NCBI Official Synonym Full Names: serpin family A member 5
• NCBI Official Symbol: SERPINA5
• NCBI Official Synonym Symbols: PCI; PAI3; PAI-3; PCI-B; PROCI; PLANH3
• NCBI Protein Information: plasma serine protease inhibitor
• UniProt Protein Name: Plasma serine protease inhibitor
• Protein Family: Plasma serine protease inhibitor
• UniProt Gene Name: SERPINA5
• UniProt Synonym Gene Names: PCI; PLANH3; PROCI; PAI-3; PAI3; PCI

NCBI Description

The protein encoded by this gene is a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. This gene is one in a cluster of serpin genes located on the q arm of chromosome 14. This family member is a glycoprotein that can inhibit several serine proteases, including protein C and various plasminogen activators and kallikreins, and it thus plays diverse roles in hemostasis and thrombosis in multiple organs. [provided by RefSeq, Aug 2012]

Uniprot Description

Heparin-dependent serine protease inhibitor acting in body fluids and secretions. Inactivates serine proteases by binding irreversibly to their serine activation site. Involved in the regulation of intravascular and extravascular proteolytic activities. Plays hemostatic roles in the blood plasma. Acts as a procoagulant and proinflammatory factor by inhibiting the anticoagulant activated protein C factor as well as the generation of activated protein C factor by the thrombin/thrombomodulin complex. Acts as an anticoagulant factor by inhibiting blood coagulation factors like prothrombin, factor XI, factor Xa, plasma kallikrein and fibrinolytic enzymes such as tissue- and urinary-type plasminogen activators. In seminal plasma, inactivates several serine proteases implicated in the reproductive system. Inhibits the serpin acrosin; indirectly protects component of the male genital tract from being degraded by excessive released acrosin. Inhibits tissue-and urinary-type plasminogen activator, prostate-specific antigen and kallikrein activities; has a control on the sperm motility and fertilization. Inhibits the activated protein C-catalyzed degradation of SEMG1 and SEMG2; regulates the degradation of semenogelin during the process of transfer of spermatozoa from the male reproductive tract into the female tract. In urine, inhibits urinary-type plasminogen activator and kallikrein activities. Inactivates membrane-anchored serine proteases activities such as MPRSS7 and TMPRSS11E. Inhibits urinary-type plasminogen activator-dependent tumor cell invasion and metastasis. May also play a non-inhibitory role in seminal plasma and urine as a hydrophobic hormone carrier by its binding to retinoic acid.