Mouse GHRL Monoclonal Antibody | anti-GHRL antibody

GHRL (Ghrelin/obestatin Prepropeptide, MTLRP, obestatin) (PE)

Cat. Num. AAA6184558

• Gene Names: GHRL; MTLRP
• Applications: Western Blot
• Purity: Purified
• Synonyms: GHRL; Monoclonal Antibody; GHRL (Ghrelin/obestatin Prepropeptide; MTLRP; obestatin) (PE); Ghrelin/obestatin Prepropeptide; obestatin; anti-GHRL antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F2
• Specificity: Recognizes GHRL.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 117

• Applicable Applications for anti-GHRL antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GHRL (NP_057446, 24aa-117aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GHRL is approximately 3ng/ml as a capture antibody.)

Related Product Information for anti-GHRL antibody

This gene encodes ghrelin-obestatin preproprotein, which generates ghrelin and obestatin. Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Obestatin was initially reported to be an endogenous ligand for the orphan G protein-coupled receptor GPR39 and was involved in satiety and decreased food intake; however, these findings are controversial. Recent reports show that obestatin is involved in inhibiting thirst and anxiety, improving memory, regulating sleep, affecting cell proliferation, and increasing the secretion of pancreatic juice enzymes. Alternative promoters and alternative splicing result in multiple transcript variants, some of which encode different protein isoforms and some of which do not encode a protein but may regulate the ghrelin-obestatin preproprotein expression. In addition, antisense transcripts for this gene have been identified and may also function in regulation of the ghrelin-obestatin preproprotein expression. [provided by RefSeq]

Product Categories/Family for anti-GHRL antibody

Antibodies; Obesity Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7706519
• NCBI GeneID: 51738
• NCBI Accession #: NP_057446
• NCBI GenBank Nucleotide #: NP_057446.1
• UniProt Accession #: Q9UBU3
• NCBI Official Full Name: appetite-regulating hormone isoform 1 preproprotein
• NCBI Official Synonym Full Names: ghrelin and obestatin prepropeptide
• NCBI Official Symbol: GHRL
• NCBI Official Synonym Symbols: MTLRP
• NCBI Protein Information: appetite-regulating hormone
• UniProt Protein Name: Appetite-regulating hormone
• Protein Family: Ghrelin
• UniProt Gene Name: GHRL
• UniProt Synonym Gene Names: MTLRP; Ghrelin
• UniProt Entry Name: GHRL_HUMAN

NCBI Description

This gene encodes the ghrelin-obestatin preproprotein that is cleaved to yield two peptides, ghrelin and obestatin. Ghrelin is a powerful appetite stimulant and plays an important role in energy homeostasis. Its secretion is initiated when the stomach is empty, whereupon it binds to the growth hormone secretagogue receptor in the hypothalamus which results in the secretion of growth hormone (somatotropin). Ghrelin is thought to regulate multiple activities, including hunger, reward perception via the mesolimbic pathway, gastric acid secretion, gastrointestinal motility, and pancreatic glucose-stimulated insulin secretion. It was initially proposed that obestatin plays an opposing role to ghrelin by promoting satiety and thus decreasing food intake, but this action is still debated. Recent reports suggest multiple metabolic roles for obestatin, including regulating adipocyte function and glucose metabolism. Alternative splicing results in multiple transcript variants. In addition, antisense transcripts for this gene have been identified and may potentially regulate ghrelin-obestatin preproprotein expression. [provided by RefSeq, Nov 2014]

Uniprot Description

ghrelin: a hormone that binds to the growth hormone secretagogue receptor type 1 (GHSR). Secreted by the stomach

Protein type: Secreted; Cell development/differentiation; Cell cycle regulation; Secreted, signal peptide; Apoptosis

Chromosomal Location of Human Ortholog: 3p26-p25

Cellular Component: extracellular space; endoplasmic reticulum lumen; axon; extracellular region

Molecular Function: growth hormone-releasing hormone activity; G-protein-coupled receptor binding; ghrelin receptor binding; protein tyrosine kinase activator activity

Biological Process: cortisol secretion; negative regulation of circadian sleep/wake cycle, REM sleep; positive regulation of cortisol secretion; hormone-mediated signaling; activation of MAPK activity; response to hormone stimulus; negative regulation of interleukin-6 biosynthetic process; positive regulation of multicellular organism growth; decidualization; positive regulation of adrenocorticotropic hormone secretion; negative regulation of insulin secretion; growth hormone secretion; elevation of cytosolic calcium ion concentration; negative regulation of locomotion; positive regulation of appetite; dendrite development; negative regulation of tumor necrosis factor biosynthetic process; positive regulation of circadian sleep/wake cycle, non-REM sleep; regulation of response to food; gastric acid secretion; positive regulation of insulin secretion; glucose metabolic process; adult feeding behavior; negative regulation of interleukin-1 beta production; regulation of cell proliferation; positive regulation of growth hormone secretion; positive regulation of synaptogenesis; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; cellular protein metabolic process; response to estrogen stimulus; negative regulation of inflammatory response; cartilage development; actin polymerization and/or depolymerization; negative regulation of endothelial cell proliferation; regulation of excitatory postsynaptic membrane potential; negative regulation of apoptosis

Disease: Obesity