Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-VBP1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Rabbit VBP1 Polyclonal Antibody | anti-VBP1 antibody

VBP1 antibody - C-terminal region

Gene Names
VBP1; PFD3; PFDN3; VBP-1; HIBBJ46
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VBP1; Polyclonal Antibody; VBP1 antibody - C-terminal region; anti-VBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDSTKNKA
Sequence Length
197
Applicable Applications for anti-VBP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-VBP1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Western Blot (WB) (WB Suggested Anti-VBP1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-VBP1 antibody
This is a rabbit polyclonal antibody against VBP1. It was validated on Western Blot

Target Description: The protein encoded by this gene interacts with the Von Hippel-Lindau protein to form an intracellular complex. Because it functions as a chaperone protein, it is suspected that it may play a role in the transport of the Von Hippel-Lindau protein from the perinuclear granules to the nucleus or cytoplasm.
Product Categories/Family for anti-VBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
prefoldin subunit 3 isoform 1
NCBI Official Synonym Full Names
VHL binding protein 1
NCBI Official Symbol
VBP1
NCBI Official Synonym Symbols
PFD3; PFDN3; VBP-1; HIBBJ46
NCBI Protein Information
prefoldin subunit 3
UniProt Protein Name
Prefoldin subunit 3
UniProt Gene Name
VBP1
UniProt Synonym Gene Names
PFDN3; VBP-1; VHL-binding protein 1
UniProt Entry Name
PFD3_HUMAN

NCBI Description

The protein encoded by this gene interacts with the Von Hippel-Lindau protein to form an intracellular complex. The encoded protein functions as a chaperone protein, and may play a role in the transport of the Von Hippel-Lindau protein from the perinuclear granules to the nucleus or cytoplasm. Alternative splicing and the use of alternate transcription start sites results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Jan 2015]

Uniprot Description

VBP1: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Belongs to the prefoldin subunit alpha family.

Protein type: Chaperone

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: intracellular membrane-bound organelle; cytoplasm; prefoldin complex; nucleus

Molecular Function: protein binding

Biological Process: 'de novo' posttranslational protein folding; cellular protein metabolic process; protein folding

Research Articles on VBP1

Similar Products

Product Notes

The VBP1 vbp1 (Catalog #AAA3216432) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VBP1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's VBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VBP1 vbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSTATKNLDS LEEDLDFLRD QFTTTEVNMA RVYNWDVKRR NKDDSTKNKA. It is sometimes possible for the material contained within the vial of "VBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.