Secreted frizzled-related protein 1 (SFRP1) Recombinant Protein | SFRP1 recombinant protein
Recombinant Bovine Secreted frizzled-related protein 1 (SFRP1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Secreted frizzled-related protein 1 (SFRP1); Recombinant Bovine Secreted frizzled-related protein 1 (SFRP1); SFRP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-308, Full length protein
Sequence
SEYDYVSFQSDIGAYQSGRFYTKPPQCVDIPADLRLCHNVGYKRMVLPNLLEHETMAEVKQQASSWVPLLNKNCHIGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKTFMKKMKNHECPTFQSVFK
Sequence Length
283
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SFRP1 recombinant protein
This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. Members of this family act as soluble modulators of Wnt signaling; epigenetic silencing of SFRP genes leads to deregulated activation of the Wnt-pathway which is associated with cancer. This gene may also be involved in determining the polarity of photoreceptor cells in the retina.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,763 Da
NCBI Official Full Name
secreted frizzled-related protein 1
NCBI Official Synonym Full Names
secreted frizzled related protein 1
NCBI Official Symbol
SFRP1
NCBI Protein Information
secreted frizzled-related protein 1
UniProt Protein Name
Secreted frizzled-related protein 1
Protein Family
UniProt Gene Name
SFRP1
UniProt Synonym Gene Names
FRZA; sFRP-1; FrzA protein
Uniprot Description
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP1 decreases intracellular beta-catenin levels (). Has antiproliferative effects on vascular cells, in vitro and in vivo, and can induce, in vivo, an angiogenic response. In vascular cell cycle, delays the G1 phase and entry into the S phase (). In kidney development, inhibits tubule formation and bud growth in metanephroi (). Inhibits WNT1/WNT4-mediated TCF-dependent transcription.
Similar Products
Product Notes
The SFRP1 sfrp1 (Catalog #AAA1130821) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-308, Full length protein. The amino acid sequence is listed below: SEYDYVSFQS DIGAYQSGRF YTKPPQCVDI PADLRLCHNV GYKRMVLPNL LEHETMAEVK QQASSWVPLL NKNCHIGTQV FLCSLFAPVC LDRPIYPCRW LCEAVRDSCE PVMQFFGFYW PEMLKCDKFP EGDVCIAMTP PNATEASKPQ GTTVCPPCDN ELKSEAIIEH LCASEFALRM KIKEVKKENG DKKIVPKKKK PLKLGPIKKK ELKKLVLYLK NGADCPCHQL DNLSHHFLIM GRKVKSQYLL TAIHKWDKKN KEFKTFMKKM KNHECPTFQS VFK. It is sometimes possible for the material contained within the vial of "Secreted frizzled-related protein 1 (SFRP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
