Mitochondrial import inner membrane translocase subunit Tim17-A (Timm17a) Recombinant Protein | Timm17a recombinant protein
Recombinant Rat Mitochondrial import inner membrane translocase subunit Tim17-A (Timm17a)
Gene Names
Timm17a; Tim17; Timm17
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial import inner membrane translocase subunit Tim17-A (Timm17a); Recombinant Rat Mitochondrial import inner membrane translocase subunit Tim17-A (Timm17a); Recombinant Mitochondrial import inner membrane translocase subunit Tim17-A (Timm17a); Mitochondrial import inner membrane translocase subunit Tim17-A; Inner membrane preprotein translocase Tim17a; Timm17a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-171
Sequence
MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSTIDCGMVQIRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDHSQLPSSQLPSSPFGDYRQYQ
Sequence Length
171
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,038 Da
NCBI Official Full Name
mitochondrial import inner membrane translocase subunit Tim17-A
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane 17 homolog A (yeast)
NCBI Official Symbol
Timm17a
NCBI Official Synonym Symbols
Tim17; Timm17
NCBI Protein Information
mitochondrial import inner membrane translocase subunit Tim17-A; inner membrane preprotein translocase Tim17a; translocase of inner mitochondrial membrane 17a; translocator of inner mitochondrial membrane 17a; translocator of inner mitochondrial membrane 17 kDa, a
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit Tim17-A
Protein Family
UniProt Gene Name
Timm17a
UniProt Synonym Gene Names
Mimt17; Tim17; Tim17a; Timm17
UniProt Entry Name
TI17A_RAT
NCBI Description
human homolog is a translocase in the inner mitochondrial membrane [RGD, Feb 2006]
Uniprot Description
Function: Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Subunit structure: Component of the TIM23 complex at least composed of TIMM23, some TIM17 (TIMM17A or TIMM17B) and TIMM50. The complex interacts with the TIMM44 component of the PAM complex.
Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the Tim17/Tim22/Tim23 family.
Similar Products
Product Notes
The Timm17a timm17a (Catalog #AAA1130660) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-171. The amino acid sequence is listed below: MEEYAREPCP WRIVDDCGGA FTMGTIGGGI FQAFKGFRNS PVGVNHRLRG SLTAIKTRAP QLGGSFAVWG GLFSTIDCGM VQIRGKEDPW NSITSGALTG AILAARNGPV AMVGSAAMGG ILLALIEGAG ILLTRFASAQ FPNGPQFAED HSQLPSSQLP SSPFGDYRQY Q. It is sometimes possible for the material contained within the vial of "Mitochondrial import inner membrane translocase subunit Tim17-A (Timm17a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
