SDS-PAGE
Mitochondrial import inner membrane translocase subunit Tim17-A (TIMM17A) Recombinant Protein | TIMM17A recombinant protein
Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-A (TIMM17A)
Gene Names
TIMM17A; TIM17; TIM17A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial import inner membrane translocase subunit Tim17-A (TIMM17A); Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-A (TIMM17A); Inner membrane preprotein translocase Tim17a; TIMM17A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-171aa; Full Length
Sequence
MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ
Sequence Length
171
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for TIMM17A recombinant protein
Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Product Categories/Family for TIMM17A recombinant protein
References
"The preprotein translocase of the inner mitochondrial membrane: evolutionary conservation of targeting and assembly of Tim17." Boemer U., Rassow J., Zufall N., Pfanner N., Meijer M., Maarse A.C. J. Mol. Biol. 262:389-395(1996)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45 kDa
NCBI Official Full Name
mitochondrial import inner membrane translocase subunit Tim17-A
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane 17A
NCBI Official Symbol
TIMM17A
NCBI Official Synonym Symbols
TIM17; TIM17A
NCBI Protein Information
mitochondrial import inner membrane translocase subunit Tim17-A
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit Tim17-A
Protein Family
UniProt Gene Name
TIMM17A
UniProt Synonym Gene Names
MIMT17; TIM17; TIM17A; TIMM17
Uniprot Description
Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Research Articles on TIMM17A
Similar Products
Product Notes
The TIMM17A timm17a (Catalog #AAA7057276) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-171aa; Full Length. The amino acid sequence is listed below: MEEYAREPCP WRIVDDCGGA FTMGTIGGGI FQAIKGFRNS PVGVNHRLRG SLTAIKTRAP QLGGSFAVWG GLFSMIDCSM VQVRGKEDPW NSITSGALTG AILAARNGPV AMVGSAAMGG ILLALIEGAG ILLTRFASAQ FPNGPQFAED PSQLPSTQLP SSPFGDYRQY Q. It is sometimes possible for the material contained within the vial of "Mitochondrial import inner membrane translocase subunit Tim17-A (TIMM17A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
