GTPase-activating protein RacGAP84C (RacGAP84C) Recombinant Protein | RacGAP84C recombinant protein
Recombinant Drosophila melanogaster GTPase-activating protein RacGAP84C (RacGAP84C)
Gene Names
RacGAP84C; CG2595; DmelCG2595; GAP84C; P1.7; racGAP; RacGAP(84C); RhoGAP-84C8; rnGAP; rnprot; rnprot1.7; rnRac-GAP; rnracGap; rnracGAP; rnRacGap; rnRacGAP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GTPase-activating protein RacGAP84C (RacGAP84C); Recombinant Drosophila melanogaster GTPase-activating protein RacGAP84C (RacGAP84C); RacGAP84C recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-384, Full length protein
Sequence
MISGSGSRTPSNRLYLSPVRPTMQNKRRLLREYRSYDDLSEHYRMFGSQSLDSLQDRVDMNPSGCDGLSTDGLDFCSQSHSGLLREHNFKIKSYYYNVGNCVHCRKRIRFAMASLRCRACPLRCHIGCCRQLTVNCIPQPQIGTKRGCLSDYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLRGKSTPHLGNKDTHTLCCCVKDFLRQLVHPLIPIYHRRDFEEATRHEDRLAVEMAVYLAVLELHQAHRDTLAYLMLHWQKIAESPAVRMTVNNLAVIFAPTLFGDLDLTLENVVTWQRVLKVLLLMPAGFWSQFLEVHPLPTSLGSTYDFEDRYNHRHWDSSSNLGWSSVKTYFRSMVNLSSTHL
Sequence Length
384
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,148 Da
NCBI Official Full Name
Rac GTPase activating protein at 84C, isoform B
NCBI Official Synonym Full Names
Rac GTPase activating protein at 84C
NCBI Official Symbol
RacGAP84C
NCBI Official Synonym Symbols
CG2595; DmelCG2595; GAP84C; P1.7; racGAP; RacGAP(84C); RhoGAP-84C8; rnGAP; rnprot; rnprot1.7; rnRac-GAP; rnracGap; rnracGAP; rnRacGap; rnRacGAP
NCBI Protein Information
CG2595 gene product from transcript CG2595-RA
UniProt Protein Name
GTPase-activating protein RacGAP84C
Protein Family
UniProt Gene Name
RacGAP84C
UniProt Synonym Gene Names
rnRacGAP
Uniprot Description
Involved in the morphogenesis of the adult appendages. GTPase-activating protein for p21-Rac. Promotes the exchange of Rac-bound GDP by GTP.
Similar Products
Product Notes
The RacGAP84C racgap84c (Catalog #AAA1130046) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-384, Full length protein. The amino acid sequence is listed below: MISGSGSRTP SNRLYLSPVR PTMQNKRRLL REYRSYDDLS EHYRMFGSQS LDSLQDRVDM NPSGCDGLST DGLDFCSQSH SGLLREHNFK IKSYYYNVGN CVHCRKRIRF AMASLRCRAC PLRCHIGCCR QLTVNCIPQP QIGTKRGCLS DYAPRVAPMV PALIVHCVTE IEARGLQQEG LYRVSSTREK CKRLRRKLLR GKSTPHLGNK DTHTLCCCVK DFLRQLVHPL IPIYHRRDFE EATRHEDRLA VEMAVYLAVL ELHQAHRDTL AYLMLHWQKI AESPAVRMTV NNLAVIFAPT LFGDLDLTLE NVVTWQRVLK VLLLMPAGFW SQFLEVHPLP TSLGSTYDFE DRYNHRHWDS SSNLGWSSVK TYFRSMVNLS STHL. It is sometimes possible for the material contained within the vial of "GTPase-activating protein RacGAP84C (RacGAP84C), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
