Melatonin receptor type 1A-like (mtnr1al) Recombinant Protein | mtnr1al recombinant protein
Recombinant Danio rerio Melatonin receptor type 1A-like (mtnr1al)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Melatonin receptor type 1A-like (mtnr1al); Recombinant Danio rerio Melatonin receptor type 1A-like (mtnr1al); Recombinant Melatonin receptor type 1A-like (mtnr1al); Melatonin receptor type 1A-like; Mel-1A-R-like; Mel1a receptor-like; Melatonin receptor Mel1a Z1.4 zMel1a-2; mtnr1al recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-152
Sequence
CHSLKYDKLFSNKNTVCYVILVWALTVLAIVPNWFVESLQYDPRVFSCTFAQSVSSLYTIMVVVVHFIVPIGIVTYCYLRIWILVIQVPRRVKPDSRPKIKPHDFRNFLTMFVVFVLFAVCWAPLNFIGLAVAIHPRLGQSIPEWLFTASYF
Sequence Length
152
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
17,634 Da
NCBI Official Full Name
Melatonin receptor type 1A-like
UniProt Protein Name
Melatonin receptor type 1A-like
Protein Family
UniProt Gene Name
mtnr1al
UniProt Synonym Gene Names
mel1a; mtnr1a; Mel-1A-R-like
UniProt Entry Name
MR1AL_DANRE
Uniprot Description
Function: High affinity receptor for melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibits adenylate cyclase activity
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein.
Induction: By cocaine, which increases the levels of day-time expression. Ref.2
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Similar Products
Product Notes
The Melatonin receptor type 1A-like (mtnr1al) mtnr1al (Catalog #AAA1126375) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-152. The amino acid sequence is listed below: CHSLKYDKLF SNKNTVCYVI LVWALTVLAI VPNWFVESLQ YDPRVFSCTF AQSVSSLYTI MVVVVHFIVP IGIVTYCYLR IWILVIQVPR RVKPDSRPKI KPHDFRNFLT MFVVFVLFAV CWAPLNFIGL AVAIHPRLGQ SIPEWLFTAS YF. It is sometimes possible for the material contained within the vial of "Melatonin receptor type 1A-like (mtnr1al), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
