Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Anaphase-promoting complex subunit DOC1 (DOC1) Recombinant Protein | DOC1 recombinant protein

Recombinant Saccharomyces cerevisiae Anaphase-promoting complex subunit DOC1 (DOC1)

Gene Names
DOC1; APC10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Anaphase-promoting complex subunit DOC1 (DOC1); Recombinant Saccharomyces cerevisiae Anaphase-promoting complex subunit DOC1 (DOC1); DOC1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-250, full length protein
Sequence
MDPIGINKVLDHLAPSELIKPVKSCHNKPSVLVLDDRIVDAATKDLYVNGFQEEIQYQNPTPENLQHMFHQGIEILDSARMINVTHLALWKPSSFKLGNPVDFALDDNYDTFWQSDGGQPHQLDIMFSKRMDICVMAIFFSMIADESYAPSLVKVYAGHSPSDARFYKMLEVRNVNGWVALRFLDNREDDQLLKCQFIRLLFPVNHENGKDTHLRGIRLYVPSNEPHQDTHEWAQTLPETNNVFQDAILR
Sequence Length
250
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,777 Da
NCBI Official Full Name
anaphase promoting complex subunit DOC1
NCBI Official Symbol
DOC1
NCBI Official Synonym Symbols
APC10
NCBI Protein Information
anaphase promoting complex subunit DOC1
UniProt Protein Name
Anaphase-promoting complex subunit DOC1
UniProt Gene Name
DOC1
UniProt Synonym Gene Names
APC10

Uniprot Description

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C is thought to confer substrate specificity and, in the presence of ubiquitin-conjugating E2 enzymes, it catalyzes the formation of protein-ubiquitin conjugates that are subsequently degraded by the 26S proteasome. In early mitosis, the APC/C is activated by CDC20 and targets securin PDS1, the B-type cyclin CLB5, and other anaphase inhibitory proteins for proteolysis, thereby triggering the separation of sister chromatids at the metaphase-to-anaphase transition. In late mitosis and in G1, degradation of CLB5 allows activation of the APC/C by CDH1, which is needed to destroy CDC20 and the B-type cyclin CLB2 to allow exit from mitosis and creating the low CDK state necessary for cytokinesis and for reforming prereplicative complexes in G1 prior to another round of replication. DOC1 is required, together with the coactivators CDH1 and CDC20, for recognition and binding of the substrates.

Research Articles on DOC1

Similar Products

Product Notes

The DOC1 doc1 (Catalog #AAA1124793) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-250, full length protein. The amino acid sequence is listed below: MDPIGINKVL DHLAPSELIK PVKSCHNKPS VLVLDDRIVD AATKDLYVNG FQEEIQYQNP TPENLQHMFH QGIEILDSAR MINVTHLALW KPSSFKLGNP VDFALDDNYD TFWQSDGGQP HQLDIMFSKR MDICVMAIFF SMIADESYAP SLVKVYAGHS PSDARFYKML EVRNVNGWVA LRFLDNREDD QLLKCQFIRL LFPVNHENGK DTHLRGIRLY VPSNEPHQDT HEWAQTLPET NNVFQDAILR. It is sometimes possible for the material contained within the vial of "Anaphase-promoting complex subunit DOC1 (DOC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.