Glycoprotein K (gK) Recombinant Protein | UL53 recombinant protein
Recombinant Human herpesvirus 2 Glycoprotein K (gK)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycoprotein K (gK); Recombinant Human herpesvirus 2 Glycoprotein K (gK); Recombinant Glycoprotein K (gK); Glycoprotein K; gK; Syncytial protein; UL53 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
31-338
Sequence
ASPLHRCIYAVRPAGAHNDTALVWMKINQTLLFLGPPTAPPGGAWTPHARVCYANIIEGRAVSLPAIPGAMSRRVMNVHEAVNCLEALWDTQMRLVVVGWFLYLAFVALHQRRCMFGVVSPAHSMVAPATYLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQTLVQLFEADPVTFLYHRPAIGVIVGCELLLRFVALGLIVGTALISRGACAITHPLFLTITTWCFVSIIALTELYFILRRGSAPKNAEPAAPRGRSKGWSGVCGRCCSIILSGIAVRLCYIAVVAGVVLVALRYEQEIQRRLFDL
Sequence Length
338
Species
Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Symbol
UL53
NCBI Protein Information
type 3 membrane protein; contains a signal peptide; 4 transmembrane domains; involved in virion morphogenesis; involved in membrane fusion
Uniprot Description
Glycoprotein that probably modulates membrane fusion events during secondary envelopment of cytoplasmic capsids that bud into specific trans-Golgi network (TGN)-derived membranes. Also plays a role, together with gB, in virus-induced cell-to-cell fusion (syncytia formation). Seems to block fusion of virions with infected-cell membranes ().
Similar Products
Product Notes
The UL53 (Catalog #AAA1123866) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-338. The amino acid sequence is listed below: ASPLHRCIYA VRPAGAHNDT ALVWMKINQT LLFLGPPTAP PGGAWTPHAR VCYANIIEGR AVSLPAIPGA MSRRVMNVHE AVNCLEALWD TQMRLVVVGW FLYLAFVALH QRRCMFGVVS PAHSMVAPAT YLLNYAGRIV SSVFLQYPYT KITRLLCELS VQRQTLVQLF EADPVTFLYH RPAIGVIVGC ELLLRFVALG LIVGTALISR GACAITHPLF LTITTWCFVS IIALTELYFI LRRGSAPKNA EPAAPRGRSK GWSGVCGRCC SIILSGIAVR LCYIAVVAGV VLVALRYEQE IQRRLFDL. It is sometimes possible for the material contained within the vial of "Glycoprotein K (gK), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
