Yippee-like 3 Recombinant Protein | YPEL3 recombinant protein

Recombinant Human Protein yippee-like 3

Cat. Num. AAA1117869

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Yippee-like 3; Recombinant Human Protein yippee-like 3; YPEL3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-119aa; Full Length
• Sequence: MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD
• Sequence Length: 119

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for YPEL3 recombinant protein

Involved in proliferation and apoptosis in myeloid precursor cells.

Product Categories/Family for YPEL3 recombinant protein

Epigenetics and Nuclear Signaling

References

Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.Hosono K., Sasaki T., Minoshima S., Shimizu N.Gene 340:31-43(2004) Cloning and characterization of FKSG5, a novel gene related to DiGeorge syndrome.Wang Y.-G.The sequence and analysis of duplication-rich human chromosome 16.Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J., Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.Nature 432:988-994(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 224465222
• NCBI GeneID: 83719
• NCBI Accession #: NP_001138996.1
• NCBI GenBank Nucleotide #: NM_001145524.1
• UniProt Accession #: P61236; Q65Z99; Q86VK6; Q9BSJ4; Q9CQB6
• Molecular Weight: 29.6 kDa
• NCBI Official Full Name: protein yippee-like 3 isoform 2
• NCBI Official Synonym Full Names: yippee like 3
• NCBI Official Symbol: YPEL3
• NCBI Protein Information: protein yippee-like 3
• UniProt Protein Name: Protein yippee-like 3
• Protein Family: Protein yippee
• UniProt Gene Name: YPEL3
• UniProt Entry Name: YPEL3_HUMAN

Uniprot Description

YPEL3: Involved in proliferation and apoptosis in myeloid precursor cells. Belongs to the yippee family. 2 isoforms of the human protein are produced by alternative splicing

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: nucleolus