Alpha-2-HS-glycoprotein (AHSG) Recombinant Protein | AHSG recombinant protein
Recombinant Guinea pig Alpha-2-HS-glycoprotein (AHSG)
Gene Names
Ahsg; FETUA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-2-HS-glycoprotein (AHSG); Recombinant Guinea pig Alpha-2-HS-glycoprotein (AHSG); AHSG recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-358, Full length protein
Sequence
TPVVLGLEERNPACDDPETEAAALAGVDYLNQHVRWGYKHVLNQIDKVRVWPRRPSGEVYELEFDTLETTCHALDITPLANCSVRTVTQHAVEGDCDMHVLKQDGQFSVVFAKCESTPDSREDVRKVCPQCPLLTPVNNTKVVHAANAALAAFNAQNNGSHFELLEISRAQLVPLPVSTYVEFAVVATDCAAADGTDPACSGPPKKQYGFCKATVAEKLGGEEVSVTCTVFPTQPVAPLPQPDAASSANPPPAADPAVSPPSSPSVPVDSVALGPKRVLLPPPVHREHYNLRYSFPDVDSASGEAFGPRQKPKVTHPGVASGVGPVPPPPCPGRIRHFKI
Sequence Length
340
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for AHSG recombinant protein
Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,472 Da
NCBI Official Full Name
alpha-2-HS-glycoprotein
NCBI Official Symbol
Ahsg
NCBI Official Synonym Symbols
FETUA
NCBI Protein Information
alpha-2-HS-glycoprotein
UniProt Protein Name
Alpha-2-HS-glycoprotein
Protein Family
UniProt Gene Name
AHSG
UniProt Synonym Gene Names
FETUA
Similar Products
Product Notes
The AHSG ahsg (Catalog #AAA1106702) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-358, Full length protein. The amino acid sequence is listed below: TPVVLGLEER NPACDDPETE AAALAGVDYL NQHVRWGYKH VLNQIDKVRV WPRRPSGEVY ELEFDTLETT CHALDITPLA NCSVRTVTQH AVEGDCDMHV LKQDGQFSVV FAKCESTPDS REDVRKVCPQ CPLLTPVNNT KVVHAANAAL AAFNAQNNGS HFELLEISRA QLVPLPVSTY VEFAVVATDC AAADGTDPAC SGPPKKQYGF CKATVAEKLG GEEVSVTCTV FPTQPVAPLP QPDAASSANP PPAADPAVSP PSSPSVPVDS VALGPKRVLL PPPVHREHYN LRYSFPDVDS ASGEAFGPRQ KPKVTHPGVA SGVGPVPPPP CPGRIRHFKI. It is sometimes possible for the material contained within the vial of "Alpha-2-HS-glycoprotein (AHSG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
