Western Blot (WB)
(WB Suggested Anti-RWDD3 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellRWDD3 is supported by BioGPS gene expression data to be expressed in HEK293T)
Rabbit RWDD3 Polyclonal Antibody | anti-RWDD3 antibody
RWDD3 antibody - middle region
Gene Names
RWDD3; RSUME
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RWDD3; Polyclonal Antibody; RWDD3 antibody - middle region; anti-RWDD3 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLWI
Sequence Length
267
Applicable Applications for anti-RWDD3 antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RWDD3 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellRWDD3 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-RWDD3 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellRWDD3 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-RWDD3 antibody
This is a rabbit polyclonal antibody against RWDD3. It was validated on Western Blot
Target Description: RWDD3 enhances the sumoylation of a number of proteins including HIF1A, PIAS and I-kappa-B, through direct interaction with UBC9. RWDD3 has no effect on ubiquitination.
Target Description: RWDD3 enhances the sumoylation of a number of proteins including HIF1A, PIAS and I-kappa-B, through direct interaction with UBC9. RWDD3 has no effect on ubiquitination.
Product Categories/Family for anti-RWDD3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
RWD domain-containing protein 3 isoform a
NCBI Official Synonym Full Names
RWD domain containing 3
NCBI Official Symbol
RWDD3
NCBI Official Synonym Symbols
RSUME
NCBI Protein Information
RWD domain-containing protein 3
UniProt Protein Name
RWD domain-containing protein 3
Protein Family
UniProt Gene Name
RWDD3
UniProt Synonym Gene Names
RSUME; RSUME
UniProt Entry Name
RWDD3_HUMAN
Uniprot Description
RWDD3: Enhances the sumoylation of a number of proteins including HIF1A, PIAS and I-kappa-B, through direct interaction with UBC9. Has no effect on ubiquitination. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: SUMO conjugating system
Chromosomal Location of Human Ortholog: 1p21.3
Cellular Component: cytoplasm; nucleus
Molecular Function: protein binding
Biological Process: positive regulation of protein sumoylation; inhibition of NF-kappaB transcription factor
Research Articles on RWDD3
Similar Products
Product Notes
The RWDD3 rwdd3 (Catalog #AAA3214311) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RWDD3 antibody - middle region reacts with Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RWDD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RWDD3 rwdd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESLLSEPMVH ELVLWIQQNL RHILSQPETG SGSEKCTFST STTMDDGLWI. It is sometimes possible for the material contained within the vial of "RWDD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
