Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged EIF2S3 is 0.3 ng/ml as a capture antibody.)

Mouse EIF2S3 Monoclonal Antibody | anti-EIF2S3 antibody

EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 gamma, 52kD, EIF2, EIF2G, EIF2gamma, eIF-2gA) (AP)

Gene Names
EIF2S3; EIF2; EIF2G; eIF-2gA; EIF2gamma
Applications
Western Blot
Purity
Purified
Synonyms
EIF2S3; Monoclonal Antibody; EIF2S3 (Eukaryotic Translation Initiation Factor 2; Subunit 3 gamma; 52kD; EIF2; EIF2G; EIF2gamma; eIF-2gA) (AP); Eukaryotic Translation Initiation Factor 2; eIF-2gA; anti-EIF2S3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H3
Specificity
Recognizes EIF2S3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EIF2S3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EIF2S3 (NP_001406, 383aa-472aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged EIF2S3 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EIF2S3 is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-EIF2S3 antibody
Mouse monoclonal antibody raised against a partial recombinant EIF2S3.
Product Categories/Family for anti-EIF2S3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,109 Da
NCBI Official Full Name
eukaryotic translation initiation factor 2 subunit 3
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
NCBI Official Symbol
EIF2S3
NCBI Official Synonym Symbols
EIF2; EIF2G; eIF-2gA; EIF2gamma
NCBI Protein Information
eukaryotic translation initiation factor 2 subunit 3; eIF-2-gamma X; eIF-2gX; eukaryotic translation initiation factor 2 subunit gamma X; eukaryotic translation initiation factor 2G
UniProt Protein Name
Eukaryotic translation initiation factor 2 subunit 3
UniProt Gene Name
EIF2S3
UniProt Synonym Gene Names
EIF2G; eIF-2-gamma X; eIF-2gX
UniProt Entry Name
IF2G_HUMAN

Uniprot Description

eIF2-gamma: eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.

Protein type: Translation; Translation initiation

Chromosomal Location of Human Ortholog: Xp22.2-p22.1

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: GTPase activity; protein binding; GTP binding; translation factor activity, nucleic acid binding; translation initiation factor activity

Biological Process: cellular protein metabolic process; translation; translational initiation; gene expression

Similar Products

Product Notes

The EIF2S3 eif2s3 (Catalog #AAA6165148) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EIF2S3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EIF2S3 eif2s3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF2S3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.