Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Glucocorticoid receptor (Nr3c1) Recombinant Protein | Nr3c1 recombinant protein

Recombinant Rat Glucocorticoid receptor (Nr3c1)

Gene Names
Nr3c1; GR; Gcr; Grl
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glucocorticoid receptor (Nr3c1); Recombinant Rat Glucocorticoid receptor (Nr3c1); Nr3c1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
547-795, full length protein
Sequence
TPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAILGLRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSGNLLCFAPDLIINEQRMSLPCMYDQCKHMLFVSSELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLTYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
Sequence Length
249
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Nr3c1 recombinant protein
This protein is a receptor for glucocorticoids that can act as both a transcription factor and as a regulator of other transcription factors. This protein can also be found in heteromeric cytoplasmic complexes along with heat shock factors and immunophilins. The protein is typically found in the cytoplasm until it binds a ligand, which induces transport into the nucleus. Mutations in this gene are a cause of glucocorticoid resistance, or cortisol, resistance. Alternate splicing, the use of at least three different promoters, and alternate translation initiation sites result in several transcript variants encoding the same protein or different isoforms, but the full-length nature of some variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,834 Da
NCBI Official Full Name
glucocorticoid receptor
NCBI Official Synonym Full Names
nuclear receptor subfamily 3, group C, member 1
NCBI Official Symbol
Nr3c1
NCBI Official Synonym Symbols
GR; Gcr; Grl
NCBI Protein Information
glucocorticoid receptor
UniProt Protein Name
Glucocorticoid receptor
Protein Family
UniProt Gene Name
Nr3c1
UniProt Synonym Gene Names
Grl; GR

NCBI Description

glucocorticoid receptor that binds and activates hormone-dependent transcriptional enhancers [RGD, Feb 2006]

Uniprot Description

Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling (PubMed:12917342). Plays a role in rapid mRNA degradation by binding to the 5' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay (). Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth ().

Research Articles on Nr3c1

Similar Products

Product Notes

The Nr3c1 nr3c1 (Catalog #AAA1105401) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 547-795, full length protein. The amino acid sequence is listed below: TPTLVSLLEV IEPEVLYAGY DSSVPDSAWR IMTTLNMLGG RQVIAAVKWA KAILGLRNLH LDDQMTLLQY SWMFLMAFAL GWRSYRQSSG NLLCFAPDLI INEQRMSLPC MYDQCKHMLF VSSELQRLQV SYEEYLCMKT LLLLSSVPKE GLKSQELFDE IRMTYIKELG KAIVKREGNS SQNWQRFYQL TKLLDSMHEV VENLLTYCFQ TFLDKTMSIE FPEMLAEIIT NQIPKYSNGN IKKLLFHQK. It is sometimes possible for the material contained within the vial of "Glucocorticoid receptor (Nr3c1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.