Tax1-binding protein 3 (TAX1BP3) Recombinant Protein | TAX1BP3 recombinant protein

Recombinant Human Tax1-binding protein 3 (TAX1BP3)

Cat. Num. AAA1098552

• Gene Names: TAX1BP3; TIP1; TIP-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tax1-binding protein 3 (TAX1BP3); Recombinant Human Tax1-binding protein 3 (TAX1BP3); TAX1BP3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-124, Full length protein
• Sequence: SYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
• Sequence Length: 123

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 325296954
• NCBI GeneID: 30851
• NCBI Accession #: NP_001191627.1
• NCBI GenBank Nucleotide #: NM_001204698.1
• UniProt Accession #: O14907; Q7LCQ4; B2RD53; D3DTJ6
• Molecular Weight: 13,735 Da
• NCBI Official Full Name: tax1-binding protein 3 isoform 2
• NCBI Official Synonym Full Names: Tax1 binding protein 3
• NCBI Official Symbol: TAX1BP3
• NCBI Official Synonym Symbols: TIP1; TIP-1
• NCBI Protein Information: tax1-binding protein 3
• UniProt Protein Name: Tax1-binding protein 3
• Protein Family: Tax1-binding protein
• UniProt Gene Name: TAX1BP3
• UniProt Synonym Gene Names: TIP-1

NCBI Description

This gene encodes a small, highly conserved protein with a single PDZ domain. PDZ (PSD-95/Discs large/ZO-1 homologous) domains promote protein-protein interactions that affect cell signaling, adhesion, protein scaffolding, and receptor and ion transporter functions. The encoded protein interacts with a large number of target proteins that play roles in signaling pathways; for example, it interacts with Rho A and glutaminase L and also acts as a negative regulator of the Wnt/beta-catenin signaling pathway. This protein was first identified as binding to the T-cell leukaemia virus (HTLV1) Tax oncoprotein. Overexpression of this gene has been implicated in altered cancer cell adhesion, migration and metastasis. The encoded protein also modulates the localization and density of inwardly rectifying potassium channel 2.3 (Kir2.3). To date, this protein has been shown to play a role in cell proliferation, development, stress response, and polarization. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2017]

Uniprot Description

May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.