Integrin beta-like protein 1 (ITGBL1) Recombinant Protein | ITGBL1 recombinant protein
Recombinant Human Integrin beta-like protein 1 (ITGBL1)
Gene Names
ITGBL1; OSCP; TIED
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Integrin beta-like protein 1 (ITGBL1); Recombinant Human Integrin beta-like protein 1 (ITGBL1); ITGBL1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-494. Full Length of Mature Protein
Sequence
VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,909 Da
NCBI Official Full Name
integrin beta-like protein 1 isoform 4
NCBI Official Synonym Full Names
integrin subunit beta like 1
NCBI Official Symbol
ITGBL1
NCBI Official Synonym Symbols
OSCP; TIED
NCBI Protein Information
integrin beta-like protein 1
UniProt Protein Name
Integrin beta-like protein 1
Protein Family
UniProt Gene Name
ITGBL1
UniProt Synonym Gene Names
OSCP; TIED
NCBI Description
This gene encodes a beta integrin-related protein that is a member of the EGF-like protein family. The encoded protein contains integrin-like cysteine-rich repeats. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]
Research Articles on ITGBL1
Similar Products
Product Notes
The ITGBL1 itgbl1 (Catalog #AAA1089719) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-494. Full Length of Mature Protein. The amino acid sequence is listed below: VPQSFSPSLR SWPGAACRLS RAESERRCRA PGQPPGAALC HGRGRCDCGV CICHVTEPGM FFGPLCECHE WVCETYDGST CAGHGKCDCG KCKCDQGWYG DACQYPTNCD LTKKKSNQMC KNSQDIICSN AGTCHCGRCK CDNSDGSGLV YGKFCECDDR ECIDDETEEI CGGHGKCYCG NCYCKAGWHG DKCEFQCDIT PWESKRRCTS PDGKICSNRG TCVCGECTCH DVDPTGDWGD IHGDTCECDE RDCRAVYDRY SDDFCSGHGQ CNCGRCDCKA GWYGKKCEHP QSCTLSAEES IRKCQGSSDL PCSGRGKCEC GKCTCYPPGD RRVYGKTCEC DDRRCEDLDG VVCGGHGTCS CGRCVCERGW FGKLCQHPRK CNMTEEQSKN LCESADGILC SGKGSCHCGK CICSAEEWYI SGEFCDCDDR DCDKHDGLIC TGNGICSCGN CECWDGWNGN ACEIWLGSEY P. It is sometimes possible for the material contained within the vial of "Integrin beta-like protein 1 (ITGBL1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
