Discs overgrown protein kinase (dco) Recombinant Protein | dco recombinant protein
Recombinant Drosophila melanogaster Discs overgrown protein kinase (dco)
Gene Names
dco; 0538/13; 0915/10; 1396/02; 1447/01; 1460/09; CG2048; CK1delta/epsilon; ck1epsilon; CK1epsilon; CKIepsilon; dbt; Dbt; DBT; DBT/CK1epsilon; dCKIepsilon; Dco; DCO; dco-1; Dco/CK1; DCO/CKIe; ddbt; DmelCG2048; l(3)dco; l(3)dco-1; l(3)discs overgrown; l(3)discs
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Discs overgrown protein kinase (dco); Recombinant Drosophila melanogaster Discs overgrown protein kinase (dco); dco recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-440, Full length protein
Sequence
MELRVGNKYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIRTKHPQLHIESKFYKTMQGGIGIPRIIWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMISRIDYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGLKAANKRQKYERISEKKLSTSIVVLCKGFPSEFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLKFGGPRNPQAIQQAQDGADGQAGHDAVAAAAAVAAAAAASSHQQQQHKVNAALGGGGGSAAQQQLQGGQTLAMLGGNGGGNGSQLIGGNGLNMDDSMAATNSSRPPYDTPERRPSIRMRQGGGGGGGGVGVGGMPSGGGGGGVGNAK
Sequence Length
440
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,958 Da
NCBI Official Full Name
discs overgrown, isoform D
NCBI Official Synonym Full Names
discs overgrown
NCBI Official Symbol
dco
NCBI Official Synonym Symbols
0538/13; 0915/10; 1396/02; 1447/01; 1460/09; CG2048; CK1delta/epsilon; ck1epsilon; CK1epsilon; CKIepsilon; dbt; Dbt; DBT; DBT/CK1epsilon; dCKIepsilon; Dco; DCO; dco-1; Dco/CK1; DCO/CKIe; ddbt; DmelCG2048; l(3)dco; l(3)dco-1; l(3)discs overgrown; l(3)discs
NCBI Protein Information
CG2048 gene product from transcript CG2048-RD
UniProt Protein Name
Discs overgrown protein kinase
Protein Family
UniProt Gene Name
dco
UniProt Synonym Gene Names
dbt
Uniprot Description
Involved in circadian rhythms, viability and molecular oscillations of the clock genes period (per) and timeless (tim). Dbt reduces the stability and thus the accumulation of monomeric per proteins, probably through phosphorylation. No evident circadian oscillation is detected in head. Together with CkIalpha, regulates processing of ci by phosphorylating it which promotes its binding to slmb, the F-box recognition component of the SCF(slmb) E3 ubiquitin-protein ligase (PubMed:16326393).
Research Articles on dco
Similar Products
Product Notes
The dco dco (Catalog #AAA1064473) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-440, Full length protein. The amino acid sequence is listed below: MELRVGNKYR LGRKIGSGSF GDIYLGTTIN TGEEVAIKLE CIRTKHPQLH IESKFYKTMQ GGIGIPRIIW CGSEGDYNVM VMELLGPSLE DLFNFCSRRF SLKTVLLLAD QMISRIDYIH SRDFIHRDIK PDNFLMGLGK KGNLVYIIDF GLAKKFRDAR SLKHIPYREN KNLTGTARYA SINTHLGIEQ SRRDDLESLG YVLMYFNLGA LPWQGLKAAN KRQKYERISE KKLSTSIVVL CKGFPSEFVN YLNFCRQMHF DQRPDYCHLR KLFRNLFHRL GFTYDYVFDW NLLKFGGPRN PQAIQQAQDG ADGQAGHDAV AAAAAVAAAA AASSHQQQQH KVNAALGGGG GSAAQQQLQG GQTLAMLGGN GGGNGSQLIG GNGLNMDDSM AATNSSRPPY DTPERRPSIR MRQGGGGGGG GVGVGGMPSG GGGGGVGNAK. It is sometimes possible for the material contained within the vial of "Discs overgrown protein kinase (dco), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
