Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Vasopressin V2 receptor (Avpr2) Recombinant Protein | Avpr2 recombinant protein

Recombinant Mouse Vasopressin V2 receptor (Avpr2)

Gene Names
Avpr2; DI1; DIR; ND1; V2R; ADHR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vasopressin V2 receptor (Avpr2); Recombinant Mouse Vasopressin V2 receptor (Avpr2); Recombinant Vasopressin V2 receptor (Avpr2); Vasopressin V2 receptor; V2R; AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor; Avpr2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-371
Sequence
MILVSTTSAVPGALSSPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLGALIRRGRRGRWAPMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQRDVGNGSGVFDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLVPGPSERAGRRRRGHRTGSPSEGAHVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEAPLERPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCAQRHTTHSLGPQDESCATASSSLMKDTPS
Sequence Length
371
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,645 Da
NCBI Official Full Name
vasopressin V2 receptor
NCBI Official Synonym Full Names
arginine vasopressin receptor 2
NCBI Official Symbol
Avpr2
NCBI Official Synonym Symbols
DI1; DIR; ND1; V2R; ADHR
NCBI Protein Information
vasopressin V2 receptor; AVPR V2; antidiuretic hormone receptor; nephrogenic diabetes insipidus; renal-type arginine vasopressin receptor
UniProt Protein Name
Vasopressin V2 receptor
Protein Family
UniProt Gene Name
Avpr2
UniProt Synonym Gene Names
V2r; V2R
UniProt Entry Name
V2R_MOUSE

NCBI Description

This gene encodes a member of the G-protein coupled receptor 1 family and the vasopressin/oxytocin receptor subfamily. The encoded protein is an arginine vasopressin receptor which, when stimulated, activates the Gs protein/adenylyl cyclase signaling cascade and is involved in water and electrolyte homeostasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Uniprot Description

AVPR2: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption. Defects in AVPR2 are the cause of nephrogenic syndrome of inappropriate antidiuresis (NSIAD). This disorder is characterized by an inability to excrete a free water load, with inappropriately concentrated urine and resultant hyponatremia, hypoosmolarity, and natriuresis. Defects in AVPR2 are the cause of diabetes insipidus nephrogenic X-linked (XNDI); also known as diabetes insipidus nephrogenic type 1. XNDI is caused by the inability of the renal collecting ducts to absorb water in response to arginine vasopressin. It is characterized by excessive water drinking (polydypsia), excessive urine excretion (polyuria), persistent hypotonic urine, and hypokalemia. Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 1; Transporter; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; Transporter, aquaporin family

Cellular Component: membrane; integral to plasma membrane; plasma membrane; integral to membrane; intracellular

Molecular Function: G-protein coupled receptor activity; signal transducer activity; peptide binding; vasopressin receptor activity

Biological Process: I-kappaB kinase/NF-kappaB cascade; G-protein coupled receptor protein signaling pathway; regulation of systemic arterial blood pressure by vasopressin; response to cytokine stimulus; positive regulation of cell proliferation; positive regulation of vasoconstriction; interferon-gamma production; positive regulation of systemic arterial blood pressure; signal transduction; positive regulation of blood pressure; cellular response to hormone stimulus

Research Articles on Avpr2

Similar Products

Product Notes

The Avpr2 avpr2 (Catalog #AAA1059472) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-371. The amino acid sequence is listed below: MILVSTTSAV PGALSSPSSP SNSSQEELLD DRDPLLVRAE LALLSTIFVA VALSNGLVLG ALIRRGRRGR WAPMHVFISH LCLADLAVAL FQVLPQLAWD ATDRFHGPDA LCRAVKYLQM VGMYASSYMI LAMTLDRHRA ICRPMLAYRH GGGARWNRPV LVAWAFSLLL SLPQLFIFAQ RDVGNGSGVF DCWARFAEPW GLRAYVTWIA LMVFVAPALG IAACQVLIFR EIHASLVPGP SERAGRRRRG HRTGSPSEGA HVSAAMAKTV RMTLVIVIVY VLCWAPFFLV QLWAAWDPEA PLERPPFVLL MLLASLNSCT NPWIYASFSS SVSSELRSLL CCAQRHTTHS LGPQDESCAT ASSSLMKDTP S. It is sometimes possible for the material contained within the vial of "Vasopressin V2 receptor (Avpr2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.