Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human EXOSC10 Monoclonal Antibody | anti-EXOSC10 antibody

EXOSC10 (Exosome Component 10, Autoantigen PM/Scl 2, P100 Polymyositis-scleroderma Overlap Syndrome-associated Autoantigen, Polymyositis/Scleroderma Autoantigen 100kD, PM/Scl-100, Polymyositis/Scleroderma Autoantigen 2, PMSCL, PMSCL2, RRP6) (Biotin)

Gene Names
EXOSC10; p2; p3; p4; RRP6; PMSCL; Rrp6p; PM-Scl; PMSCL2; PM/Scl-100
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EXOSC10; Monoclonal Antibody; EXOSC10 (Exosome Component 10; Autoantigen PM/Scl 2; P100 Polymyositis-scleroderma Overlap Syndrome-associated Autoantigen; Polymyositis/Scleroderma Autoantigen 100kD; PM/Scl-100; Polymyositis/Scleroderma Autoantigen 2; PMSCL; PMSCL2; RRP6) (Biotin); anti-EXOSC10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E6
Specificity
Recognizes human EXOSC10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-EXOSC10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human EXOSC10 (NP_001001998) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEYDFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKD
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged EXOSC10 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EXOSC10 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-EXOSC10 antibody
Putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. EXOSC10 has 3'-5' exonuclease activity By similarity. EXOSC10 is required for nucleolar localization of C1D and probably mediates the association of SKIV2L2, C1D and MPP6 wth the RNA exosome involved in the maturation of 5.8S rRNA.
Product Categories/Family for anti-EXOSC10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98,089 Da
NCBI Official Full Name
exosome component 10 isoform 1
NCBI Official Synonym Full Names
exosome component 10
NCBI Official Symbol
EXOSC10
NCBI Official Synonym Symbols
p2; p3; p4; RRP6; PMSCL; Rrp6p; PM-Scl; PMSCL2; PM/Scl-100
NCBI Protein Information
exosome component 10; P100 polymyositis-scleroderma overlap syndrome-associated autoantigen; autoantigen PM-SCL; polymyositis/scleroderma autoantigen 100 kDa; polymyositis/scleroderma autoantigen 2
UniProt Protein Name
Exosome component 10
Protein Family
UniProt Gene Name
EXOSC10
UniProt Synonym Gene Names
PMSCL; PMSCL2; RRP6; PM/Scl-100
UniProt Entry Name
EXOSX_HUMAN

Uniprot Description

EXOSC10: Putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. EXOSC10 has 3'-5' exonuclease activity. EXOSC10 is required for nucleolar localization of C1D and probably mediates the association of SKIV2L2, C1D and MPP6 wth the RNA exosome involved in the maturation of 5.8S rRNA. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Nucleolus; EC 3.1.13.-

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleolus; exosome (RNase complex); nucleus; nuclear exosome (RNase complex)

Molecular Function: protein binding; exoribonuclease activity; nucleotide binding; 3'-5' exonuclease activity

Biological Process: RNA processing; maturation of 5.8S rRNA; dosage compensation, by inactivation of X chromosome; mRNA catabolic process, nonsense-mediated decay

Similar Products

Product Notes

The EXOSC10 exosc10 (Catalog #AAA6141801) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EXOSC10 (Exosome Component 10, Autoantigen PM/Scl 2, P100 Polymyositis-scleroderma Overlap Syndrome-associated Autoantigen, Polymyositis/Scleroderma Autoantigen 100kD, PM/Scl-100, Polymyositis/Scleroderma Autoantigen 2, PMSCL, PMSCL2, RRP6) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EXOSC10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EXOSC10 exosc10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EXOSC10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.