Nucleoside diphosphate kinase 1 (NDPK1) Recombinant Protein | NDPK1 recombinant protein

Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1 (NDPK1)

Cat. Num. AAA1057475

• Gene Names: NDPK1; ATNDK1; NDK1; nucleoside diphosphate kinase 1; T30A10.80; T30A10_80
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Nucleoside diphosphate kinase 1 (NDPK1); Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1 (NDPK1); NDPK1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-149aa; Full Length
• Sequence: MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET
• Sequence Length: 149

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

NCBI and Uniprot Product Information

• NCBI GI #: 1063719826
• NCBI GeneID: 826515
• NCBI Accession #: NP_567346.2
• NCBI GenBank Nucleotide #: NM_117000.3
• UniProt Accession #: P39207; Q41989; Q94JY5; F4JJZ8
• Molecular Weight: 20.5 kDa
• NCBI Official Full Name: nucleoside diphosphate kinase
• NCBI Official Symbol: NDPK1
• NCBI Official Synonym Symbols: ATNDK1; NDK1; nucleoside diphosphate kinase 1; T30A10.80; T30A10_80
• NCBI Protein Information: nucleoside diphosphate kinase
• UniProt Protein Name: Nucleoside diphosphate kinase 1
• UniProt Gene Name: NDK1
• UniProt Synonym Gene Names: NDPK1; NDK I; NDP kinase I; NDPK I

NCBI Description

nucleoside diphosphate kinase type 1 (NDPK1) gene, complete

Uniprot Description

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress.