Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Autophagy-related protein 32 (ATG32) Recombinant Protein | ATG32 recombinant protein

Recombinant Saccharomyces cerevisiae Autophagy-related protein 32 (ATG32)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Autophagy-related protein 32 (ATG32); Recombinant Saccharomyces cerevisiae Autophagy-related protein 32 (ATG32); Recombinant Autophagy-related protein 32 (ATG32); Autophagy-related protein 32; Extracellular mutant protein 37; ATG32 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-529
Sequence
MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPSPMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGDEDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSPGKPVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYCRNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTVKSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLTIIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL
Sequence Length
529
Species
Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
58,938 Da
UniProt Protein Name
Autophagy-related protein 32
Protein Family
UniProt Gene Name
ATG32
UniProt Synonym Gene Names
ECM17
UniProt Entry Name
ATG32_YEAS1

Uniprot Description

Function: Mitophagy-specific receptor that recruits the autophagic machinery to mitochondria and regulates selective degradation of mitochondria

By similarity.

Subunit structure: interacts with ATG8 and ATG11

By similarity.

Subcellular location: Mitochondrion outer membrane; Single-pass membrane protein

By similarity. Vacuole

By similarity. Note: Is imported into the vacuole along with mitochondria during starvation

By similarity.

Sequence similarities: Belongs to the ATG32 family.

Similar Products

Product Notes

The Autophagy-related protein 32 (ATG32) atg32 (Catalog #AAA1044949) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-529. The amino acid sequence is listed below: MVLEYQQREG KGSSSKSMPP DSSSTTIHTC SEAQTGEDKG LLDPHLSVLE LLSKTGHSPS PMGQNLVTSI DISGNHNVND SISGSWQAIQ PLDLGASFIP ERCSSQTTNG SILSSSDTSE EEQELLQAPA ADIINIIKQG QEGANVVSPS HPFKQLQKII SLPLPGKEKT PFNEQDDDGD EDEAFEEDSV TITKSLTSST NSFVMPKLSL TQKNPVFRLL ILGRTGSSFY QSIPKEYQSL FELPKYHDSA TFPQYTGIVI IFQELREMVS LLNRIVQYSP GKPVIPICQP GQVIQVKNVL KSFLRNKLVK LLFPPVVVTN KRDLKKMFQR LQDLSLEYGE DVNEEDNDDE AIHTKSRSYC RNKKAENSKK KSPKSNKKPK RKKQKFFTSW FTWGISITIG ISFGCCVTYF VTAAYEHQTV KSLSLRPSIL ASLLSLDSSS DTINTPATAS PSSTEQFLWF DKGTLQINFH SDGFIMKSLT IIKETWGKMN TFVLHALSKP LKFLENLNKS SEFSIDESNR ILALGYILL. It is sometimes possible for the material contained within the vial of "Autophagy-related protein 32 (ATG32), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.