Autophagy-related protein 17 (ATG17) Recombinant Protein | ATG17 recombinant protein
Recombinant Vanderwaltozyma polyspora Autophagy-related protein 17 (ATG17)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Autophagy-related protein 17 (ATG17); Recombinant Vanderwaltozyma polyspora Autophagy-related protein 17 (ATG17); ATG17 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-413, Full length protein
Sequence
MKIERFVNASRKTLVEAQVLCQDANSRISNARSSFSHWERSISKIRFLLNCLKNQGSFIKNCILKVGIEENLIEKEWTQSILVDLAKELKYWNSKINEQVRVLDSIENILDEDTKSESKNLGYFVSRDNLDILEKRLKEIPNVKYHIDNIRGQYNTMFKKVSNYLINKRLKSVQEYFLTNFENDSDDIKKLTTTLPSKLVSLEHDLADYLSSITNHYDQSKLLQTLKPADPDYTDLLEVVKNDNSELDGIVTLLRETVDEVDETLKTFLGIFNEIELKQKECNKLLFGVIEEFKINHEYLLIFNDISSLIDNFKETCIEDINNTRSLCIFYQKFEIGYQNLLFEIERRKTVAQKMTDIIKNCELELSKINEEDQKNRSEFLKLNGDYLPENIWPGKIDDFSPLYSLEYSIKEI
Sequence Length
413
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,447 Da
NCBI Official Full Name
hypothetical protein Kpol_1052p29
NCBI Official Symbol
Kpol_1052p29
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Autophagy-related protein 17
Protein Family
UniProt Gene Name
ATG17
Uniprot Description
Autophagy-specific protein that functions in response to autophagy-inducing signals as a scaffold to recruit other ATG proteins to organize pre-autophagosomal structure (PAS) formation. Modulates the timing and magnitude of the autophagy response, such as the size of the sequestering vesicles. Plays particularly a role in pexophagy and nucleophagy ().
Similar Products
Product Notes
The ATG17 atg17 (Catalog #AAA1042277) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-413, Full length protein. The amino acid sequence is listed below: MKIERFVNAS RKTLVEAQVL CQDANSRISN ARSSFSHWER SISKIRFLLN CLKNQGSFIK NCILKVGIEE NLIEKEWTQS ILVDLAKELK YWNSKINEQV RVLDSIENIL DEDTKSESKN LGYFVSRDNL DILEKRLKEI PNVKYHIDNI RGQYNTMFKK VSNYLINKRL KSVQEYFLTN FENDSDDIKK LTTTLPSKLV SLEHDLADYL SSITNHYDQS KLLQTLKPAD PDYTDLLEVV KNDNSELDGI VTLLRETVDE VDETLKTFLG IFNEIELKQK ECNKLLFGVI EEFKINHEYL LIFNDISSLI DNFKETCIED INNTRSLCIF YQKFEIGYQN LLFEIERRKT VAQKMTDIIK NCELELSKIN EEDQKNRSEF LKLNGDYLPE NIWPGKIDDF SPLYSLEYSI KEI. It is sometimes possible for the material contained within the vial of "Autophagy-related protein 17 (ATG17), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
