NADH-cytochrome b5 reductase 2 (MCR1) Recombinant Protein | PGUG_05495 recombinant protein
Recombinant Meyerozyma guilliermondii NADH-cytochrome b5 reductase 2 (MCR1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NADH-cytochrome b5 reductase 2 (MCR1); Recombinant Meyerozyma guilliermondii NADH-cytochrome b5 reductase 2 (MCR1); Recombinant NADH-cytochrome b5 reductase 2 (MCR1); NADH-cytochrome b5 reductase 2 EC= 1.6.2.2; Mitochondrial cytochrome b reductase; PGUG_05495 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-294
Sequence
MSLARFTQPRVLLPVVAAATSIGLVYHYSSLSIQNDTAKTFKGGDEWIDLKLKKSWDVSSNTRHFVFELKSPEDVSGLVTASCLMTKFVTAKGNNVIRPYTPVSDVDQKGTIDFVIKKYDGGKMSTHFHGLKEGDTVSFKGPIVKWKWEPNQFQSIALIGGGTGITPLYQLLHEITKNPEDKTKVKLFYGNLTEEDILIKKELDDIAEKHKDQVSITYFVDKASANWKGETGHIDKEFLQSNLPGPSKDSKVFVCGPPGLYKALSGVKVSPTDQGEVTGVLAELGYTKENVYKF
Sequence Length
294
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,570 Da
NCBI Official Full Name
hypothetical protein PGUG_05495
NCBI Official Symbol
PGUG_05495
NCBI Protein Information
hypothetical protein
UniProt Protein Name
NADH-cytochrome b5 reductase 2
UniProt Gene Name
MCR1
UniProt Entry Name
MCR1_PICGU
Uniprot Description
Function: May mediate the reduction of outer membrane cytochrome b5
By similarity.
Catalytic activity: NADH + 2 ferricytochrome b5 = NAD+ + H+ + 2 ferrocytochrome b5.
Cofactor: FAD
By similarity.
Subcellular location: Mitochondrion outer membrane; Single-pass membrane protein
By similarity.
Sequence similarities: Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.Contains 1 FAD-binding FR-type domain.
Similar Products
Product Notes
The PGUG_05495 mcr1 (Catalog #AAA1039813) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-294. The amino acid sequence is listed below: MSLARFTQPR VLLPVVAAAT SIGLVYHYSS LSIQNDTAKT FKGGDEWIDL KLKKSWDVSS NTRHFVFELK SPEDVSGLVT ASCLMTKFVT AKGNNVIRPY TPVSDVDQKG TIDFVIKKYD GGKMSTHFHG LKEGDTVSFK GPIVKWKWEP NQFQSIALIG GGTGITPLYQ LLHEITKNPE DKTKVKLFYG NLTEEDILIK KELDDIAEKH KDQVSITYFV DKASANWKGE TGHIDKEFLQ SNLPGPSKDS KVFVCGPPGL YKALSGVKVS PTDQGEVTGV LAELGYTKEN VYKF. It is sometimes possible for the material contained within the vial of "NADH-cytochrome b5 reductase 2 (MCR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
