SDS-PAGE
Eukaryotic translation initiation factor 5A-1 Recombinant Protein | HYP2 recombinant protein
Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Eukaryotic translation initiation factor 5A-1
Gene Names
HYP2; TIF51A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Eukaryotic translation initiation factor 5A-1; Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Eukaryotic translation initiation factor 5A-1; Hypusine-containing protein HP2; eIF-4D; HYP2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-157aa; Full Length
Sequence
SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
Sequence Length
157
Species
Saccharomyces cerevisiae (strain # 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for HYP2 recombinant protein
mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell.
References
"Translation initiation factor 5A and its hypusine modification are essential for cell viability in the yeast Saccharomyces cerevisiae."
Schnier J., Schwelberger H.G., Smit-Mcbride Z., Kang H.A., Hershey J.W.B.
Mol. Cell. Biol. 11:3105-3114(1991)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33 kDa
NCBI Official Full Name
translation elongation factor eIF-5A
NCBI Official Symbol
HYP2
NCBI Official Synonym Symbols
TIF51A
NCBI Protein Information
translation elongation factor eIF-5A
UniProt Protein Name
Eukaryotic translation initiation factor 5A-1
Protein Family
UniProt Gene Name
HYP2
UniProt Synonym Gene Names
TIF51A; eIF-5A-1
UniProt Entry Name
IF5A1_YEAST
Uniprot Description
mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell.
Research Articles on HYP2
Similar Products
Product Notes
The HYP2 hyp2 (Catalog #AAA1035922) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-157aa; Full Length. The amino acid sequence is listed below: SDEEHTFETA DAGSSATYPM QCSALRKNGF VVIKSRPCKI VDMSTSKTGK HGHAKVHLVA IDIFTGKKLE DLSPSTHNME VPVVKRNEYQ LLDIDDGFLS LMNMDGDTKD DVKAPEGELG DSLQTAFDEG KDLMVTIISA MGEEAAISFK EAARTD. It is sometimes possible for the material contained within the vial of "Eukaryotic translation initiation factor 5A-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
